LOCUS HUMCGB 539 bp mRNA linear HUM 10-APR-1996 DEFINITION Human chorionic gonadotropin (hcg) beta subunit mRNA, complete cds. ACCESSION J00117 M38559 M54963 VERSION J00117.1 KEYWORDS chorionic gonadotropin; glycoprotein; gonadotropin; hormone. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 539) AUTHORS Fiddes,J.C. and Goodman,H.M. TITLE The cDNA for the beta-subunit of human chorionic gonadotropin suggests evolution of a gene by readthrough into the 3'-untranslated region JOURNAL Nature 286 (5774), 684-687 (1980) PUBMED 6774259 COMMENT Original source text: Homo sapiens placenta cDNA to mRNA. Human chorionic gonadotropin (hcg) is functionally and structurally related to three other glycoprotein hormones: luteinizing hormone, follicle-stimulating hormone and thyroid-stimulating hormone. The alpha subunits for the four proteins seem to be coded by a single gene (see loci beginning <humglyca>). The beta subunit for hcg differs from the beta subunits for the other three hormones in that the C-terminus appears to have been extended by about thirty amino acids. [1] presents evidence that this has occurred by the loss of a termination codon for the hcg gene. FEATURES Location/Qualifiers source 1..539 /db_xref="H-InvDB:HIT000191041_04" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="19q13.3" /tissue_type="placenta" gene 1..539 /gene="CGB" mRNA <1..539 /gene="CGB" /note="G00-119-055" CDS 26..523 /gene="CGB" /codon_start=1 /product="chorionic gonadotropin beta subunit" /protein_id="AAA96690.1" /db_xref="GDB:G00-119-055" /translation="MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCP VCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSY AVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDT PILPQ" sig_peptide 29..85 /gene="CGB" /note="G00-119-055" mat_peptide 86..520 /gene="CGB" /product="chorionic gonadotropin beta subunit" /note="G00-119-055" BASE COUNT 88 a 205 c 151 g 95 t ORIGIN 25 bases 5' to the putative first codon; chromosome 19q13.3. 1 agacaaggca ggggacgcac caaggatgga gatgttccag gggctgctgc tgttgctgct 61 gctgagcatg ggcgggacat gggcatccaa ggagccgctt cggccacggt gccgccccat 121 caatgccacc ctggctgtgg agaaggaggg ctgccccgtg tgcatcaccg tcaacaccac 181 catctgtgcc ggctactgcc ccaccatgac ccgcgtgctg cagggggtcc tgccggccct 241 gcctcaggtg gtgtgcaact accgcgatgt gcgcttcgag tccatccggc tccctggctg 301 cccgcgcggc gtgaaccccg tggtctccta cgccgtggct ctcagctgtc aatgtgcact 361 ctgccgccgc agcaccactg actgcggggg tcccaaggac caccccttga cctgtgatga 421 cccccgcttc caggactcct cttcctcaaa ggcccctccc cccagccttc caagcccatc 481 ccgactcccg gggccctcgg acaccccgat cctcccacaa taaaggcttc tcaatccgc //