LOCUS       HUMCGB                   539 bp    mRNA    linear   HUM 10-APR-1996
DEFINITION  Human chorionic gonadotropin (hcg) beta subunit mRNA, complete cds.
ACCESSION   J00117 M38559 M54963
VERSION     J00117.1
KEYWORDS    chorionic gonadotropin; glycoprotein; gonadotropin; hormone.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 539)
  AUTHORS   Fiddes,J.C. and Goodman,H.M.
  TITLE     The cDNA for the beta-subunit of human chorionic gonadotropin
            suggests evolution of a gene by readthrough into the
            3'-untranslated region
  JOURNAL   Nature 286 (5774), 684-687 (1980)
   PUBMED   6774259
COMMENT     Original source text: Homo sapiens placenta cDNA to mRNA.
            Human chorionic gonadotropin (hcg) is functionally and structurally
            related to three other glycoprotein hormones: luteinizing hormone,
            follicle-stimulating hormone and thyroid-stimulating hormone. The
            alpha subunits for the four proteins seem to be coded by a single
            gene (see loci beginning <humglyca>). The beta subunit for hcg
            differs from the beta subunits for the other three hormones in that
            the C-terminus appears to have been extended by about thirty amino
            acids. [1] presents evidence that this has occurred by the loss of
            a termination codon for the hcg gene.
FEATURES             Location/Qualifiers
     source          1..539
                     /db_xref="H-InvDB:HIT000191041_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="19q13.3"
                     /tissue_type="placenta"
     gene            1..539
                     /gene="CGB"
     mRNA            <1..539
                     /gene="CGB"
                     /note="G00-119-055"
     CDS             26..523
                     /gene="CGB"
                     /codon_start=1
                     /product="chorionic gonadotropin beta subunit"
                     /protein_id="AAA96690.1"
                     /db_xref="GDB:G00-119-055"
                     /translation="MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCP
                     VCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSY
                     AVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDT
                     PILPQ"
     sig_peptide     29..85
                     /gene="CGB"
                     /note="G00-119-055"
     mat_peptide     86..520
                     /gene="CGB"
                     /product="chorionic gonadotropin beta subunit"
                     /note="G00-119-055"
BASE COUNT           88 a          205 c          151 g           95 t
ORIGIN      25 bases 5' to the putative first codon; chromosome 19q13.3.
        1 agacaaggca ggggacgcac caaggatgga gatgttccag gggctgctgc tgttgctgct
       61 gctgagcatg ggcgggacat gggcatccaa ggagccgctt cggccacggt gccgccccat
      121 caatgccacc ctggctgtgg agaaggaggg ctgccccgtg tgcatcaccg tcaacaccac
      181 catctgtgcc ggctactgcc ccaccatgac ccgcgtgctg cagggggtcc tgccggccct
      241 gcctcaggtg gtgtgcaact accgcgatgt gcgcttcgag tccatccggc tccctggctg
      301 cccgcgcggc gtgaaccccg tggtctccta cgccgtggct ctcagctgtc aatgtgcact
      361 ctgccgccgc agcaccactg actgcggggg tcccaaggac caccccttga cctgtgatga
      421 cccccgcttc caggactcct cttcctcaaa ggcccctccc cccagccttc caagcccatc
      481 ccgactcccg gggccctcgg acaccccgat cctcccacaa taaaggcttc tcaatccgc
//