LOCUS HM994915 167 bp mRNA linear HUM 25-JUL-2016 DEFINITION Homo sapiens isolate P1_Agg_3.1.6 immunoglobulin variable region mRNA, partial cds. ACCESSION HM994915 VERSION HM994915.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 167) AUTHORS Scheel,T. and Berek,C. TITLE Variable-region gene repertoire analysis of locally defined synovial B and plasma cells reveals selected B cell expansion and the accumulation of large plasma cell clones JOURNAL Unpublished REFERENCE 2 (bases 1 to 167) AUTHORS Scheel,T. and Berek,C. TITLE Direct Submission JOURNAL Submitted (28-JUL-2010) B Cell Immunology, Deutsches Rheuma Forschungszentrum, Chariteplatz 1, Berlin 10117, Germany FEATURES Location/Qualifiers source 1..167 /db_xref="H-InvDB:HIT000651220_01" /organism="Homo sapiens" /mol_type="mRNA" /isolate="P1_Agg_3.1.6" /db_xref="taxon:9606" /cell_type="B lymphocyte; plasma cell" /tissue_type="synovial tissue" CDS <1..>167 /note="Ig" /codon_start=1 /product="immunoglobulin variable region" /protein_id="ADX64821.1" /translation="VQLVESGGGLVQPGGSLRLSCAASGFIFSTYDMHWVRQTTGKAS TKGPSVFPLAPS" BASE COUNT 29 a 54 c 49 g 35 t ORIGIN 1 gtgcagctgg tggagtctgg gggaggcttg gtacagcctg gggggtccct gagactctcc 61 tgtgcagcct ctggattcat cttcagtacc tacgacatgc actgggtccg ccaaactaca 121 ggaaaagcct ccaccaaggg cccatcggtc ttccccctgg cgccctc //