LOCUS       HM994915                 167 bp    mRNA    linear   HUM 25-JUL-2016
DEFINITION  Homo sapiens isolate P1_Agg_3.1.6 immunoglobulin variable region
            mRNA, partial cds.
ACCESSION   HM994915
VERSION     HM994915.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 167)
  AUTHORS   Scheel,T. and Berek,C.
  TITLE     Variable-region gene repertoire analysis of locally defined
            synovial B and plasma cells reveals selected B cell expansion and
            the accumulation of large plasma cell clones
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 167)
  AUTHORS   Scheel,T. and Berek,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUL-2010) B Cell Immunology, Deutsches Rheuma
            Forschungszentrum, Chariteplatz 1, Berlin 10117, Germany
FEATURES             Location/Qualifiers
     source          1..167
                     /db_xref="H-InvDB:HIT000651220_01"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="P1_Agg_3.1.6"
                     /db_xref="taxon:9606"
                     /cell_type="B lymphocyte; plasma cell"
                     /tissue_type="synovial tissue"
     CDS             <1..>167
                     /note="Ig"
                     /codon_start=1
                     /product="immunoglobulin variable region"
                     /protein_id="ADX64821.1"
                     /translation="VQLVESGGGLVQPGGSLRLSCAASGFIFSTYDMHWVRQTTGKAS
                     TKGPSVFPLAPS"
BASE COUNT           29 a           54 c           49 g           35 t
ORIGIN      
        1 gtgcagctgg tggagtctgg gggaggcttg gtacagcctg gggggtccct gagactctcc
       61 tgtgcagcct ctggattcat cttcagtacc tacgacatgc actgggtccg ccaaactaca
      121 ggaaaagcct ccaccaaggg cccatcggtc ttccccctgg cgccctc
//