LOCUS       FR748206                  98 bp    mRNA    linear   HUM 18-JUL-2011
DEFINITION  Homo sapiens partial mRNA for transcription factor 4 isoform E
            (TCF4 gene).
ACCESSION   FR748206
VERSION     FR748206.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 98)
  AUTHORS   Sepp M.
  JOURNAL   Submitted (01-DEC-2010) to the INSDC. Sepp M., Department of Gene
            Technolgy, Tallinn University of Technology, Akadeemia tee 15,
            12618 Tallinn, ESTONIA.
REFERENCE   2
  AUTHORS   Sepp M., Kannike K., Eesmaa A., Urb M., Timmusk T.
  TITLE     functional diversity of human basic helix-loop-helix transcription
            factor TCF4 isoforms generated by alternative 5' exon usage and
            splicing
  JOURNAL   PLoS One 6(7), e22138-e22138(2011).
   PUBMED   21789225
FEATURES             Location/Qualifiers
     source          1..98
                     /db_xref="H-InvDB:HIT000714768"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /tissue_type="brain"
                     /db_xref="taxon:9606"
     CDS             <1..>98
                     /codon_start=3
                     /gene="TCF4"
                     /product="transcription factor 4, isoform E"
                     /note="exons 3c, 4"
                     /db_xref="UniProtKB/TrEMBL:G0LNT5"
                     /protein_id="CBY80185.1"
                     /translation="QIVTDDLRKNEMFSPPVSSGKNGPTSLASGHF"
BASE COUNT           29 a           16 c           24 g           29 t
ORIGIN      
        1 ttcagattgt aactgacgat ctgaggaaaa atgagatgtt ttcacctcct gtgagcagtg
       61 ggaaaaatgg accaacttct ttggcaagtg gacatttt
//