LOCUS FR748206 98 bp mRNA linear HUM 18-JUL-2011 DEFINITION Homo sapiens partial mRNA for transcription factor 4 isoform E (TCF4 gene). ACCESSION FR748206 VERSION FR748206.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 98) AUTHORS Sepp M. JOURNAL Submitted (01-DEC-2010) to the INSDC. Sepp M., Department of Gene Technolgy, Tallinn University of Technology, Akadeemia tee 15, 12618 Tallinn, ESTONIA. REFERENCE 2 AUTHORS Sepp M., Kannike K., Eesmaa A., Urb M., Timmusk T. TITLE functional diversity of human basic helix-loop-helix transcription factor TCF4 isoforms generated by alternative 5' exon usage and splicing JOURNAL PLoS One 6(7), e22138-e22138(2011). PUBMED 21789225 FEATURES Location/Qualifiers source 1..98 /db_xref="H-InvDB:HIT000714768" /organism="Homo sapiens" /mol_type="mRNA" /tissue_type="brain" /db_xref="taxon:9606" CDS <1..>98 /codon_start=3 /gene="TCF4" /product="transcription factor 4, isoform E" /note="exons 3c, 4" /db_xref="UniProtKB/TrEMBL:G0LNT5" /protein_id="CBY80185.1" /translation="QIVTDDLRKNEMFSPPVSSGKNGPTSLASGHF" BASE COUNT 29 a 16 c 24 g 29 t ORIGIN 1 ttcagattgt aactgacgat ctgaggaaaa atgagatgtt ttcacctcct gtgagcagtg 61 ggaaaaatgg accaacttct ttggcaagtg gacatttt //