LOCUS       EU181432                 208 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens interleukin 1 receptor-like 1 isoform 1 (IL1RL1) mRNA,
            partial cds, alternatively spliced.
ACCESSION   EU181432
VERSION     EU181432.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 208)
  AUTHORS   Houghton-Trivino,N., Salgado,D.M., Rodriguez,J.A., Bosch,I. and
            Castellanos,J.E.
  TITLE     Levels of soluble ST2 in serum associated with severity of dengue
            due to tumour necrosis factor alpha stimulation
  JOURNAL   J. Gen. Virol. 91 (PT 3), 697-706 (2010)
   PUBMED   19889931
REFERENCE   2  (bases 1 to 208)
  AUTHORS   Houghton,N. and Castellanos,J.E.
  TITLE     Expression and function of T1/ST2 during dengue virus infection in
            patients and cells
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 208)
  AUTHORS   Houghton,N. and Castellanos,J.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2007) Instituto de Virologia, Universidad El
            Bosque, Transversal 9A Bis #132-55, Bogota, Cundinamarca, Colombia
FEATURES             Location/Qualifiers
     source          1..208
                     /db_xref="H-InvDB:HIT000484704"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2q12"
                     /cell_type="HUVEC"
                     /PCR_primers="fwd_seq: aatgatggaaagctctatg, rev_seq:
                     gaaaccaacatacgaaaga"
     gene            <1..>208
                     /gene="IL1RL1"
     CDS             <1..>208
                     /gene="IL1RL1"
                     /note="soluble protein receptor; T1/ST2 is member of
                     interleukin-1 receptor family (R-IL1); can be induced by
                     pro-inflammatory stimuli and it may have an
                     immunoregulatory function, inhibiting signaling pathways
                     used by IL-1R and Toll-like receptor 4 (TLR4); may be
                     involved in the function of helper T cells; alternatively
                     spliced"
                     /codon_start=1
                     /product="interleukin 1 receptor-like 1 isoform 1"
                     /protein_id="ABW33705.1"
                     /translation="NDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGY
                     TLCIYGRDMLPGEDVVTAVETNIRK"
BASE COUNT           64 a           39 c           49 g           56 t
ORIGIN      
        1 aatgatggaa agctctatga tgcttatgtt gtctacccac ggaactacaa atccagtaca
       61 gatggggcca gtcgtgtaga gcactttgtt caccagattc tgcctgatgt tcttgaaaat
      121 aaatgtggct ataccttatg catttatggg agagatatgc tacctggaga agatgtagtc
      181 actgcagtgg aaaccaacat acgaaaga
//