LOCUS EU181431 201 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens interleukin 1 receptor-like 1 isoform 2 (IL1RL1) mRNA, partial cds, alternatively spliced. ACCESSION EU181431 VERSION EU181431.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 201) AUTHORS Houghton-Trivino,N., Salgado,D.M., Rodriguez,J.A., Bosch,I. and Castellanos,J.E. TITLE Levels of soluble ST2 in serum associated with severity of dengue due to tumour necrosis factor alpha stimulation JOURNAL J. Gen. Virol. 91 (PT 3), 697-706 (2010) PUBMED 19889931 REFERENCE 2 (bases 1 to 201) AUTHORS Houghton,N. and Castellanos,J.E. TITLE Expression and function of T1/ST2 during dengue virus infection in patients and cells JOURNAL Unpublished REFERENCE 3 (bases 1 to 201) AUTHORS Houghton,N. and Castellanos,J.E. TITLE Direct Submission JOURNAL Submitted (27-SEP-2007) Instituto de Virologia, Universidad El Bosque, Transversal 9A Bis #132-55, Bogota, Cundinamarca, Colombia FEATURES Location/Qualifiers source 1..201 /db_xref="H-InvDB:HIT000484703" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2q12" /cell_type="HUVEC" /PCR_primers="fwd_seq: gaaccaagaattcaacaag, rev_seq: caagtaaggagtgtttctga" gene <1..201 /gene="IL1RL1" CDS <1..201 /gene="IL1RL1" /note="soluble protein receptor; T1/ST2 is member of interleukin-1 receptor family (R-IL1); can be induced by pro-inflammatory stimuli and it may have an immunoregulatory function, inhibiting signaling pathways used by IL-1R and Toll-like receptor 4 (TLR4); may be involved in the function of helper T cells; alternatively spliced" /codon_start=1 /product="interleukin 1 receptor-like 1 isoform 2" /protein_id="ABW33704.1" /translation="EPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLAL NLHGLRRHTVRLSRKNPSKECF" BASE COUNT 67 a 32 c 55 g 47 t ORIGIN 1 gaaccaagaa ttcaacaaga ggaagggcaa aatcaaagtt tcagcaatgg gctggcttgt 61 ctagacatgg ttttaagaat agctgacgtg aaggaagagg atttattgct gcagtacgac 121 tgtctggccc tgaatttgca tggcttgaga aggcacaccg taagactaag taggaaaaat 181 ccaagtaagg agtgtttctg a //