LOCUS       DQ524028                 349 bp    mRNA    linear   HUM 14-JUL-2016
DEFINITION  Homo sapiens clone 05g08 immunoglobulin heavy chain variable region
            mRNA, partial cds.
ACCESSION   DQ524028
VERSION     DQ524028.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 349)
  AUTHORS   Zemlin,M., Hoersch,G., Zemlin,C., Pohl-Schickinger,A., Hummel,M.,
            Berek,C., Maier,R.F. and Bauer,K.
  TITLE     The postnatal maturation of the immunoglobulin heavy chain IgG
            repertoire in human preterm neonates is slower than in term
            neonates
  JOURNAL   J. Immunol. 178 (2), 1180-1188 (2007)
   PUBMED   17202383
REFERENCE   2  (bases 1 to 349)
  AUTHORS   Zemlin,M., Hoersch,G., Zemlin,C., Pohl,A., Hummel,M., Berek,C.,
            Maier,R.F. and Bauer,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAY-2006) Pediatrics, Philipps University Marburg,
            Baldinger Str., Marburg 35043, Germany
FEATURES             Location/Qualifiers
     source          1..349
                     /db_xref="H-InvDB:HIT000392610"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="case 4190-5,54"
                     /db_xref="taxon:9606"
                     /clone="05g08"
                     /tissue_type="peripheral blood"
                     /dev_stage="neonate"
     CDS             <1..>349
                     /note="IgG"
                     /codon_start=1
                     /product="immunoglobulin heavy chain variable region"
                     /protein_id="ABI35540.1"
                     /translation="ESGGGVVRPGGSLRLPCAASGFTFDDYGMSWVRQAPGEGLEWVS
                     GINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCARVGAALTGNW
                     FDPWGQGTLVTVSS"
BASE COUNT           70 a           87 c          115 g           77 t
ORIGIN      
        1 gagtctgggg gaggtgtggt acggcctggg gggtccctga gactcccctg tgcagcctct
       61 ggattcacct ttgatgatta tggcatgagc tgggtccgcc aagctccagg ggaggggctg
      121 gagtgggtct ctggtattaa ttggaatggt ggtagcacag gttatgcaga ctctgtgaag
      181 ggccgattca ccatctccag agacaacgcc aagaactccc tgtatctgca aatgaacagt
      241 ctgagagccg aggacacggc cttgtattac tgtgcgagag ttggagcagc cctgactggg
      301 aactggttcg acccctgggg ccagggaacc ctggtcaccg tctcctcag
//