LOCUS DQ524028 349 bp mRNA linear HUM 14-JUL-2016 DEFINITION Homo sapiens clone 05g08 immunoglobulin heavy chain variable region mRNA, partial cds. ACCESSION DQ524028 VERSION DQ524028.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 349) AUTHORS Zemlin,M., Hoersch,G., Zemlin,C., Pohl-Schickinger,A., Hummel,M., Berek,C., Maier,R.F. and Bauer,K. TITLE The postnatal maturation of the immunoglobulin heavy chain IgG repertoire in human preterm neonates is slower than in term neonates JOURNAL J. Immunol. 178 (2), 1180-1188 (2007) PUBMED 17202383 REFERENCE 2 (bases 1 to 349) AUTHORS Zemlin,M., Hoersch,G., Zemlin,C., Pohl,A., Hummel,M., Berek,C., Maier,R.F. and Bauer,K. TITLE Direct Submission JOURNAL Submitted (02-MAY-2006) Pediatrics, Philipps University Marburg, Baldinger Str., Marburg 35043, Germany FEATURES Location/Qualifiers source 1..349 /db_xref="H-InvDB:HIT000392610" /organism="Homo sapiens" /mol_type="mRNA" /isolate="case 4190-5,54" /db_xref="taxon:9606" /clone="05g08" /tissue_type="peripheral blood" /dev_stage="neonate" CDS <1..>349 /note="IgG" /codon_start=1 /product="immunoglobulin heavy chain variable region" /protein_id="ABI35540.1" /translation="ESGGGVVRPGGSLRLPCAASGFTFDDYGMSWVRQAPGEGLEWVS GINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCARVGAALTGNW FDPWGQGTLVTVSS" BASE COUNT 70 a 87 c 115 g 77 t ORIGIN 1 gagtctgggg gaggtgtggt acggcctggg gggtccctga gactcccctg tgcagcctct 61 ggattcacct ttgatgatta tggcatgagc tgggtccgcc aagctccagg ggaggggctg 121 gagtgggtct ctggtattaa ttggaatggt ggtagcacag gttatgcaga ctctgtgaag 181 ggccgattca ccatctccag agacaacgcc aagaactccc tgtatctgca aatgaacagt 241 ctgagagccg aggacacggc cttgtattac tgtgcgagag ttggagcagc cctgactggg 301 aactggttcg acccctgggg ccagggaacc ctggtcaccg tctcctcag //