LOCUS       DQ516082                 270 bp    mRNA    linear   HUM 04-APR-2007
DEFINITION  Homo sapiens islet amyloid polypeptide precursor (IAPP) mRNA,
            complete cds.
ACCESSION   DQ516082
VERSION     DQ516082.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 270)
  AUTHORS   Bhattacharya,S., Latha,J.N., Kumresan,R. and Singh,S.
  TITLE     Cloning and expression of human islet amyloid polypeptide in
            cultured cells
  JOURNAL   Biochem. Biophys. Res. Commun. 356 (3), 622-628 (2007)
   PUBMED   17374526
REFERENCE   2  (bases 1 to 270)
  AUTHORS   Singh,S., Susinjan,B. and Lavanya Latha,J.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-APR-2006) Cell and Molecular Biology, Center for
            Cellular and Molecular Biology, Habsiguda, Uppal Road, Hyderabad,
            Andhra Pradesh 500 007, India
FEATURES             Location/Qualifiers
     source          1..270
                     /db_xref="H-InvDB:HIT000392420"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="pancrease"
                     /dev_stage="fetus"
     gene            1..270
                     /gene="IAPP"
     CDS             1..270
                     /gene="IAPP"
                     /note="amylin precursor"
                     /codon_start=1
                     /product="islet amyloid polypeptide precursor"
                     /protein_id="ABG27010.1"
                     /translation="MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQR
                     LANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL"
     sig_peptide     1..66
                     /gene="IAPP"
     misc_feature    67..267
                     /gene="IAPP"
                     /note="encodes islet amyloid protein proprotein"
     mat_peptide     100..213
                     /gene="IAPP"
                     /product="islet amyloid protein"
BASE COUNT           78 a           63 c           58 g           71 t
ORIGIN      
        1 atgggcatcc tgaagctgca agtatttctc attgtgctct ctgttgcatt gaaccatctg
       61 aaagctacac ccattgaaag tcatcaggtg gaaaagcgga aatgcaacac tgccacatgt
      121 gcaacgcagc gcctggcaaa ttttttagtt cattccagca acaactttgg tgccattctc
      181 tcatctacca acgtgggatc caatacatat ggcaagagga atgcagtaga ggttttaaag
      241 agagagccac tgaattactt gcccctttag
//