LOCUS DQ516082 270 bp mRNA linear HUM 04-APR-2007 DEFINITION Homo sapiens islet amyloid polypeptide precursor (IAPP) mRNA, complete cds. ACCESSION DQ516082 VERSION DQ516082.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 270) AUTHORS Bhattacharya,S., Latha,J.N., Kumresan,R. and Singh,S. TITLE Cloning and expression of human islet amyloid polypeptide in cultured cells JOURNAL Biochem. Biophys. Res. Commun. 356 (3), 622-628 (2007) PUBMED 17374526 REFERENCE 2 (bases 1 to 270) AUTHORS Singh,S., Susinjan,B. and Lavanya Latha,J.N. TITLE Direct Submission JOURNAL Submitted (25-APR-2006) Cell and Molecular Biology, Center for Cellular and Molecular Biology, Habsiguda, Uppal Road, Hyderabad, Andhra Pradesh 500 007, India FEATURES Location/Qualifiers source 1..270 /db_xref="H-InvDB:HIT000392420" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /tissue_type="pancrease" /dev_stage="fetus" gene 1..270 /gene="IAPP" CDS 1..270 /gene="IAPP" /note="amylin precursor" /codon_start=1 /product="islet amyloid polypeptide precursor" /protein_id="ABG27010.1" /translation="MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQR LANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL" sig_peptide 1..66 /gene="IAPP" misc_feature 67..267 /gene="IAPP" /note="encodes islet amyloid protein proprotein" mat_peptide 100..213 /gene="IAPP" /product="islet amyloid protein" BASE COUNT 78 a 63 c 58 g 71 t ORIGIN 1 atgggcatcc tgaagctgca agtatttctc attgtgctct ctgttgcatt gaaccatctg 61 aaagctacac ccattgaaag tcatcaggtg gaaaagcgga aatgcaacac tgccacatgt 121 gcaacgcagc gcctggcaaa ttttttagtt cattccagca acaactttgg tgccattctc 181 tcatctacca acgtgggatc caatacatat ggcaagagga atgcagtaga ggttttaaag 241 agagagccac tgaattactt gcccctttag //