LOCUS       DQ454536                 280 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens clone rvgc47a27 immunoglobulin heavy chain variable
            region (IGH) mRNA, partial cds.
ACCESSION   DQ454536
VERSION     DQ454536.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 280)
  AUTHORS   Zemlin,M., Hoersch,G., Zemlin,C., Pohl-Schickinger,A., Hummel,M.,
            Berek,C., Maier,R.F. and Bauer,K.
  TITLE     The postnatal maturation of the immunoglobulin heavy chain IgG
            repertoire in human preterm neonates is slower than in term
            neonates
  JOURNAL   J. Immunol. 178 (2), 1180-1188 (2007)
   PUBMED   17202383
REFERENCE   2  (bases 1 to 280)
  AUTHORS   Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H.
            and Zemlin,M.
  TITLE     Homology-directed recombination in IgH variable region genes from
            human neonates, infants and adults: implications for junctional
            diversity
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 280)
  AUTHORS   Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H.
            and Zemlin,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAR-2006) Pediatrics, Philipps University Marburg,
            Baldinger Str., Marburg, Hessen 35033, Germany
FEATURES             Location/Qualifiers
     source          1..280
                     /db_xref="H-InvDB:HIT000392107"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="case 3060-2,06"
                     /db_xref="taxon:9606"
                     /clone="rvgc47a27"
                     /tissue_type="peripheral blood"
                     /dev_stage="neonate"
     gene            <1..>280
                     /gene="IGH"
     CDS             <1..>280
                     /gene="IGH"
                     /note="IgG"
                     /codon_start=1
                     /product="immunoglobulin heavy chain variable region"
                     /protein_id="ABE66620.1"
                     /translation="DDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRD
                     NAKNSLYLQMNSLRAEDTALYYCAKGLYSSSWYGWFDPWGQGTLVTVSS"
BASE COUNT           66 a           68 c           85 g           61 t
ORIGIN      
        1 gatgattatg ccatgcactg ggtccggcaa gctccaggga agggcctgga gtgggtctca
       61 ggtattagtt ggaatagtgg tagcataggc tatgcggact ctgtgaaggg ccgattcacc
      121 atctccagag acaacgccaa gaactccctg tatctgcaaa tgaacagtct gagagctgag
      181 gacacggcct tgtattactg tgcaaaaggc ttgtatagca gcagctggta cggatggttc
      241 gacccctggg gccagggaac cctggtcacc gtctcctcag
//