LOCUS DQ454536 280 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens clone rvgc47a27 immunoglobulin heavy chain variable region (IGH) mRNA, partial cds. ACCESSION DQ454536 VERSION DQ454536.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 280) AUTHORS Zemlin,M., Hoersch,G., Zemlin,C., Pohl-Schickinger,A., Hummel,M., Berek,C., Maier,R.F. and Bauer,K. TITLE The postnatal maturation of the immunoglobulin heavy chain IgG repertoire in human preterm neonates is slower than in term neonates JOURNAL J. Immunol. 178 (2), 1180-1188 (2007) PUBMED 17202383 REFERENCE 2 (bases 1 to 280) AUTHORS Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H. and Zemlin,M. TITLE Homology-directed recombination in IgH variable region genes from human neonates, infants and adults: implications for junctional diversity JOURNAL Unpublished REFERENCE 3 (bases 1 to 280) AUTHORS Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H. and Zemlin,M. TITLE Direct Submission JOURNAL Submitted (20-MAR-2006) Pediatrics, Philipps University Marburg, Baldinger Str., Marburg, Hessen 35033, Germany FEATURES Location/Qualifiers source 1..280 /db_xref="H-InvDB:HIT000392107" /organism="Homo sapiens" /mol_type="mRNA" /isolate="case 3060-2,06" /db_xref="taxon:9606" /clone="rvgc47a27" /tissue_type="peripheral blood" /dev_stage="neonate" gene <1..>280 /gene="IGH" CDS <1..>280 /gene="IGH" /note="IgG" /codon_start=1 /product="immunoglobulin heavy chain variable region" /protein_id="ABE66620.1" /translation="DDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRD NAKNSLYLQMNSLRAEDTALYYCAKGLYSSSWYGWFDPWGQGTLVTVSS" BASE COUNT 66 a 68 c 85 g 61 t ORIGIN 1 gatgattatg ccatgcactg ggtccggcaa gctccaggga agggcctgga gtgggtctca 61 ggtattagtt ggaatagtgg tagcataggc tatgcggact ctgtgaaggg ccgattcacc 121 atctccagag acaacgccaa gaactccctg tatctgcaaa tgaacagtct gagagctgag 181 gacacggcct tgtattactg tgcaaaaggc ttgtatagca gcagctggta cggatggttc 241 gacccctggg gccagggaac cctggtcacc gtctcctcag //