LOCUS DQ454451 192 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens clone ra44b-8G7 immunoglobulin heavy chain variable region (IGH) mRNA, partial cds. ACCESSION DQ454451 VERSION DQ454451.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 192) AUTHORS Zemlin,M., Hoersch,G., Zemlin,C., Pohl-Schickinger,A., Hummel,M., Berek,C., Maier,R.F. and Bauer,K. TITLE The postnatal maturation of the immunoglobulin heavy chain IgG repertoire in human preterm neonates is slower than in term neonates JOURNAL J. Immunol. 178 (2), 1180-1188 (2007) PUBMED 17202383 REFERENCE 2 (bases 1 to 192) AUTHORS Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H. and Zemlin,M. TITLE Homology-directed recombination in IgH variable region genes from human neonates, infants and adults: implications for junctional diversity JOURNAL Unpublished REFERENCE 3 (bases 1 to 192) AUTHORS Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H. and Zemlin,M. TITLE Direct Submission JOURNAL Submitted (20-MAR-2006) Pediatrics, Philipps University Marburg, Baldinger Str., Marburg, Hessen 35033, Germany FEATURES Location/Qualifiers source 1..192 /db_xref="H-InvDB:HIT000392023" /organism="Homo sapiens" /mol_type="mRNA" /isolate="case 2070-1,23" /db_xref="taxon:9606" /clone="ra44b-8G7" /tissue_type="peripheral blood" /dev_stage="neonate" gene <1..>192 /gene="IGH" CDS <1..>192 /gene="IGH" /note="IgG" /codon_start=1 /product="immunoglobulin heavy chain variable region" /protein_id="ABE66535.1" /translation="QPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISADKSKNYFSLKL SSVTAADTAVYYCAGNWGYW" BASE COUNT 48 a 52 c 56 g 36 t ORIGIN 1 cagcccccag ggaaggggct ggagtggatt ggagaaatct atcatagtgg gagcaccaac 61 tacaacccgt ccctcaagag tcgagtcacc atatcagcag acaagtccaa gaactacttc 121 tccctgaagc tgagctctgt gaccgccgcg gacacggccg tgtattactg tgcgggtaac 181 tgggggtact gg //