LOCUS       DQ454451                 192 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens clone ra44b-8G7 immunoglobulin heavy chain variable
            region (IGH) mRNA, partial cds.
ACCESSION   DQ454451
VERSION     DQ454451.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 192)
  AUTHORS   Zemlin,M., Hoersch,G., Zemlin,C., Pohl-Schickinger,A., Hummel,M.,
            Berek,C., Maier,R.F. and Bauer,K.
  TITLE     The postnatal maturation of the immunoglobulin heavy chain IgG
            repertoire in human preterm neonates is slower than in term
            neonates
  JOURNAL   J. Immunol. 178 (2), 1180-1188 (2007)
   PUBMED   17202383
REFERENCE   2  (bases 1 to 192)
  AUTHORS   Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H.
            and Zemlin,M.
  TITLE     Homology-directed recombination in IgH variable region genes from
            human neonates, infants and adults: implications for junctional
            diversity
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 192)
  AUTHORS   Bauer,K., Hummel,M., Berek,C., Paar,C., Rosenberger,C., Versmold,H.
            and Zemlin,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAR-2006) Pediatrics, Philipps University Marburg,
            Baldinger Str., Marburg, Hessen 35033, Germany
FEATURES             Location/Qualifiers
     source          1..192
                     /db_xref="H-InvDB:HIT000392023"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="case 2070-1,23"
                     /db_xref="taxon:9606"
                     /clone="ra44b-8G7"
                     /tissue_type="peripheral blood"
                     /dev_stage="neonate"
     gene            <1..>192
                     /gene="IGH"
     CDS             <1..>192
                     /gene="IGH"
                     /note="IgG"
                     /codon_start=1
                     /product="immunoglobulin heavy chain variable region"
                     /protein_id="ABE66535.1"
                     /translation="QPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISADKSKNYFSLKL
                     SSVTAADTAVYYCAGNWGYW"
BASE COUNT           48 a           52 c           56 g           36 t
ORIGIN      
        1 cagcccccag ggaaggggct ggagtggatt ggagaaatct atcatagtgg gagcaccaac
       61 tacaacccgt ccctcaagag tcgagtcacc atatcagcag acaagtccaa gaactacttc
      121 tccctgaagc tgagctctgt gaccgccgcg gacacggccg tgtattactg tgcgggtaac
      181 tgggggtact gg
//