LOCUS DQ322784 297 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens immunoglobulin light chain variable region EM3-PPS-14-K1-62 mRNA, partial cds. ACCESSION DQ322784 VERSION DQ322784.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 297) AUTHORS Shriner,A.K., Smithson,S.L., Rabquer,B., Khuder,S. and Westerink,M.A. TITLE Analysis of the young and elderly variable gene repertoire in response to pneumococcal polysaccharides using a reconstituted SCID mouse model JOURNAL Vaccine 24 (49-50), 7159-7166 (2006) PUBMED 16884837 REFERENCE 2 (bases 1 to 297) AUTHORS Shriner,A.K., Smithson,L., Rabquer,B.J. and Westerink,J. TITLE Direct Submission JOURNAL Submitted (08-DEC-2005) Medicine, Medical University of Ohio, 3000 Arlington Ave., Toledo, OH 43614, USA FEATURES Location/Qualifiers source 1..297 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS <1..>297 /codon_start=3 /product="immunoglobulin light chain variable region EM3-PPS-14-K1-62" /protein_id="ABC66906.1" /translation="GERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWAST RESGVPDRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYYSTPPGFGGGTKVEIK" BASE COUNT 76 a 78 c 78 g 65 t ORIGIN 1 tgggcgagag ggccaccatc aactgcaagt ccagccagag tgttttatac agctccaaca 61 ataagaacta cttagcttgg taccagcaga aaccaggaca gcctcctaag ctgctcattt 121 actgggcatc tacccgggaa tccggggtcc ctgaccgatt cagtggcagc gggtctggga 181 cagatttcac tctcaccatc agcggcctgc aggctgaaga tgtggcagtt tattactgtc 241 agcaatatta tagtactcct ccaggtttcg gcggagggac caaggtggag atcaaac //