LOCUS       DQ322784                 297 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens immunoglobulin light chain variable region
            EM3-PPS-14-K1-62 mRNA, partial cds.
ACCESSION   DQ322784
VERSION     DQ322784.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 297)
  AUTHORS   Shriner,A.K., Smithson,S.L., Rabquer,B., Khuder,S. and
            Westerink,M.A.
  TITLE     Analysis of the young and elderly variable gene repertoire in
            response to pneumococcal polysaccharides using a reconstituted SCID
            mouse model
  JOURNAL   Vaccine 24 (49-50), 7159-7166 (2006)
   PUBMED   16884837
REFERENCE   2  (bases 1 to 297)
  AUTHORS   Shriner,A.K., Smithson,L., Rabquer,B.J. and Westerink,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-DEC-2005) Medicine, Medical University of Ohio, 3000
            Arlington Ave., Toledo, OH 43614, USA
FEATURES             Location/Qualifiers
     source          1..297
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..>297
                     /codon_start=3
                     /product="immunoglobulin light chain variable region
                     EM3-PPS-14-K1-62"
                     /protein_id="ABC66906.1"
                     /translation="GERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWAST
                     RESGVPDRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYYSTPPGFGGGTKVEIK"
BASE COUNT           76 a           78 c           78 g           65 t
ORIGIN      
        1 tgggcgagag ggccaccatc aactgcaagt ccagccagag tgttttatac agctccaaca
       61 ataagaacta cttagcttgg taccagcaga aaccaggaca gcctcctaag ctgctcattt
      121 actgggcatc tacccgggaa tccggggtcc ctgaccgatt cagtggcagc gggtctggga
      181 cagatttcac tctcaccatc agcggcctgc aggctgaaga tgtggcagtt tattactgtc
      241 agcaatatta tagtactcct ccaggtttcg gcggagggac caaggtggag atcaaac
//