LOCUS       DQ322731                 378 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens immunoglobulin light chain variable region
            EM1-PPS-14-K4-20 mRNA, partial cds.
ACCESSION   DQ322731
VERSION     DQ322731.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 378)
  AUTHORS   Shriner,A.K., Smithson,S.L., Rabquer,B., Khuder,S. and
            Westerink,M.A.
  TITLE     Analysis of the young and elderly variable gene repertoire in
            response to pneumococcal polysaccharides using a reconstituted SCID
            mouse model
  JOURNAL   Vaccine 24 (49-50), 7159-7166 (2006)
   PUBMED   16884837
REFERENCE   2  (bases 1 to 378)
  AUTHORS   Shriner,A.K., Smithson,L., Rabquer,B.J. and Westerink,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-DEC-2005) Medicine, Medical University of Ohio, 3000
            Arlington Ave., Toledo, OH 43614, USA
FEATURES             Location/Qualifiers
     source          1..378
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..>378
                     /codon_start=1
                     /product="immunoglobulin light chain variable region
                     EM1-PPS-14-K4-20"
                     /protein_id="ABC66853.1"
                     /translation="ALEIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWY
                     QQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST
                     PPTFGPGTKVDIKRTVAAPSVFKG"
BASE COUNT           92 a          105 c           92 g           89 t
ORIGIN      
        1 gcccttgaaa ttgtgatgac gcagtctcca gactccctgg ctgtgtctct gggcgagagg
       61 gccaccatca actgcaagtc cagccagagt gttttataca gctccaacaa taagaactac
      121 ttagcttggt accagcagaa accaggacag cctcctaagc tgctcattta ctgggcatct
      181 acccgggaat ccggggtccc tgaccgattc agtggcagcg ggtctgggac agatttcact
      241 ctcaccatca gcagcctgca ggctgaagat gtggcagttt attactgtca gcaatattat
      301 agtactcctc caactttcgg ccctgggacc aaagtggata tcaaacgaac tgtggctgca
      361 ccatctgtct tcaagggc
//