LOCUS DQ322730 378 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens immunoglobulin light chain variable region EM1-PPS-14-K4-16 mRNA, partial cds. ACCESSION DQ322730 VERSION DQ322730.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 378) AUTHORS Shriner,A.K., Smithson,S.L., Rabquer,B., Khuder,S. and Westerink,M.A. TITLE Analysis of the young and elderly variable gene repertoire in response to pneumococcal polysaccharides using a reconstituted SCID mouse model JOURNAL Vaccine 24 (49-50), 7159-7166 (2006) PUBMED 16884837 REFERENCE 2 (bases 1 to 378) AUTHORS Shriner,A.K., Smithson,L., Rabquer,B.J. and Westerink,J. TITLE Direct Submission JOURNAL Submitted (08-DEC-2005) Medicine, Medical University of Ohio, 3000 Arlington Ave., Toledo, OH 43614, USA FEATURES Location/Qualifiers source 1..378 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS <1..>378 /codon_start=1 /product="immunoglobulin light chain variable region EM1-PPS-14-K4-16" /protein_id="ABC66852.1" /translation="ALDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWY QQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST PPTFGQGTKVDIKRTVAAPSVFKG" BASE COUNT 91 a 107 c 94 g 86 t ORIGIN 1 gcccttgaca tcgtgatgac ccagtctcca gactccctgg ctgtgtctct gggcgagagg 61 gccaccatca actgcaagtc cagccagagt gttttataca gctccaacaa taagaactac 121 ttagcttggt accagcagaa accaggacag cctcctaagc tgctcattta ctgggcatct 181 acccgggaat ccggggtccc tgaccgattc agtggcagcg ggtctgggac agatttcact 241 ctcaccatca gcagcctgca ggctgaagat gtggcagttt attactgtca gcaatattat 301 agtactcctc cgacgttcgg ccaagggacc aaggtggata tcaaacgaac tgtggctgca 361 ccatctgtct tcaagggc //