LOCUS DQ307286 808 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens plenty of SH3s-2 (POSH2) mRNA, partial cds. ACCESSION DQ307286 VERSION DQ307286.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 808) AUTHORS Renkema,G.H. and Karkkainen,S. TITLE p21-activated kinase-2 binds to the third SH3-domain of POSH2 JOURNAL Unpublished REFERENCE 2 (bases 1 to 808) AUTHORS Renkema,G.H. and Karkkainen,S. TITLE Direct Submission JOURNAL Submitted (23-NOV-2005) Biochemistry of Cell Signaling, Institute of Medical Technology, Biokatu 6, Tampere 33520, Finland FEATURES Location/Qualifiers source 1..808 /db_xref="H-InvDB:HIT000391831" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="HEK293" gene 1..>808 /gene="POSH2" CDS 1..>808 /gene="POSH2" /note="3' end of coding region available in AK074131" /codon_start=1 /product="plenty of SH3s-2" /protein_id="ABC25188.1" /translation="MDESSLLDLLECSVCLERLDTTAKVLPCQHTFCRRCLESIVCSR HELRCPECRILVGCGVDELPANILLVRLLDGIRQRPRAGTSPGGSPPARPIPGQSAAP TLAGGGGGAAGSTPGSPVFLSAAAGSTAGSLRELATSRTAPAAKNPCLLPYGKALYSY EGKEPGDLKFNKGDIIVLRRKVDEQWYHGELHGTQGFLPASYIQCIQPLPHAPPQGKA LYDFEMKDKDQDKDCLTFTKDEILTVLRRVDENWAEGMLGDKIGIFPLLYV" BASE COUNT 148 a 271 c 264 g 125 t ORIGIN 1 atggacgagt cgtcgctgct ggacctgctg gagtgctccg tgtgtctgga gcgcctggac 61 accacggcca aggtgctgcc atgccaacac actttctgcc gccgctgcct ggagagcatc 121 gtgtgctcgc gccacgagct gcgctgcccc gagtgccgca tcctggtggg ctgcggcgtg 181 gacgaactgc ccgccaacat cttgctggtg cgactgctgg acggcatccg tcagcggccc 241 cgcgcgggca ccagccccgg cggcagcccg cccgcgcgtc ccatcccagg ccagagtgcg 301 gcccccacgc tcgcgggcgg cgggggcggc gcggcaggca gcaccccggg ttccccggtt 361 ttcctctccg cggccgcggg cagcaccgcc ggcagtctgc gggagctggc gaccagcagg 421 accgcgccgg cggcaaagaa tccctgcctg cttccctatg gcaaggccct ctacagctac 481 gaggggaagg aacctggtga cctcaagttc aacaaggggg acatcatcgt cctgcggcgc 541 aaggtggatg aacagtggta ccacggcgag ctgcacggca cacagggctt cctcccagcc 601 agctatatcc agtgcatcca gcccttgcca cacgccccgc cccagggaaa agcactttat 661 gatttcgaga tgaaggacaa agaccaagac aaggactgtc tgaccttcac caaggacgag 721 attctgacgg tgctcaggag agtggatgag aactgggcgg aaggcatgct gggagacaag 781 atcgggatct tcccgctcct gtacgtgg //