LOCUS       DQ307286                 808 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens plenty of SH3s-2 (POSH2) mRNA, partial cds.
ACCESSION   DQ307286
VERSION     DQ307286.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 808)
  AUTHORS   Renkema,G.H. and Karkkainen,S.
  TITLE     p21-activated kinase-2 binds to the third SH3-domain of POSH2
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 808)
  AUTHORS   Renkema,G.H. and Karkkainen,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-NOV-2005) Biochemistry of Cell Signaling, Institute
            of Medical Technology, Biokatu 6, Tampere 33520, Finland
FEATURES             Location/Qualifiers
     source          1..808
                     /db_xref="H-InvDB:HIT000391831"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HEK293"
     gene            1..>808
                     /gene="POSH2"
     CDS             1..>808
                     /gene="POSH2"
                     /note="3' end of coding region available in AK074131"
                     /codon_start=1
                     /product="plenty of SH3s-2"
                     /protein_id="ABC25188.1"
                     /translation="MDESSLLDLLECSVCLERLDTTAKVLPCQHTFCRRCLESIVCSR
                     HELRCPECRILVGCGVDELPANILLVRLLDGIRQRPRAGTSPGGSPPARPIPGQSAAP
                     TLAGGGGGAAGSTPGSPVFLSAAAGSTAGSLRELATSRTAPAAKNPCLLPYGKALYSY
                     EGKEPGDLKFNKGDIIVLRRKVDEQWYHGELHGTQGFLPASYIQCIQPLPHAPPQGKA
                     LYDFEMKDKDQDKDCLTFTKDEILTVLRRVDENWAEGMLGDKIGIFPLLYV"
BASE COUNT          148 a          271 c          264 g          125 t
ORIGIN      
        1 atggacgagt cgtcgctgct ggacctgctg gagtgctccg tgtgtctgga gcgcctggac
       61 accacggcca aggtgctgcc atgccaacac actttctgcc gccgctgcct ggagagcatc
      121 gtgtgctcgc gccacgagct gcgctgcccc gagtgccgca tcctggtggg ctgcggcgtg
      181 gacgaactgc ccgccaacat cttgctggtg cgactgctgg acggcatccg tcagcggccc
      241 cgcgcgggca ccagccccgg cggcagcccg cccgcgcgtc ccatcccagg ccagagtgcg
      301 gcccccacgc tcgcgggcgg cgggggcggc gcggcaggca gcaccccggg ttccccggtt
      361 ttcctctccg cggccgcggg cagcaccgcc ggcagtctgc gggagctggc gaccagcagg
      421 accgcgccgg cggcaaagaa tccctgcctg cttccctatg gcaaggccct ctacagctac
      481 gaggggaagg aacctggtga cctcaagttc aacaaggggg acatcatcgt cctgcggcgc
      541 aaggtggatg aacagtggta ccacggcgag ctgcacggca cacagggctt cctcccagcc
      601 agctatatcc agtgcatcca gcccttgcca cacgccccgc cccagggaaa agcactttat
      661 gatttcgaga tgaaggacaa agaccaagac aaggactgtc tgaccttcac caaggacgag
      721 attctgacgg tgctcaggag agtggatgag aactgggcgg aaggcatgct gggagacaag
      781 atcgggatct tcccgctcct gtacgtgg
//