LOCUS       DQ200867                 216 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens CLIP-associated protein 1 beta mRNA, partial cds.
ACCESSION   DQ200867
VERSION     DQ200867.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 216)
  AUTHORS   Maiato,H., Pontes,P., Sambade,C. and Earnshaw,W.C.
  TITLE     CLASPs are distinct outer kinetochore proteins required for mitosis
            and associated with human cancers
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 216)
  AUTHORS   Maiato,H., Pontes,P., Sambade,C. and Earnshaw,W.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2005) Structural and Molecular Biology, Institute
            for Molecular and Cell Biology, Rua do Campo Alegre, 823, Porto
            4150-180, Portugal
FEATURES             Location/Qualifiers
     source          1..216
                     /db_xref="H-InvDB:HIT000391775"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2q14.2-q14.3"
     CDS             1..>216
                     /note="CLASP1-beta; microtubule- and
                     kinetochore-associated protein; required for bipolar
                     spindle architecture"
                     /codon_start=1
                     /product="CLIP-associated protein 1 beta"
                     /protein_id="ABB13627.1"
                     /translation="MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQ
                     TMLDKLVDGLATSWVNSSNYKKNFDDED"
BASE COUNT           63 a           42 c           59 g           52 t
ORIGIN      
        1 atggagcctc gcatggagtc ctgcctggcg caggtgttgc agaaggatgt ggggaaacga
       61 ttgcaggttg gccaagaact gatagactat ttctcagaca aacagaagtc tgctgacctt
      121 gagcatgacc agaccatgtt agataaactt gtggatggac ttgctacctc ttgggtgaac
      181 tctagcaatt acaagaaaaa tttcgacgat gaagat
//