LOCUS DQ200867 216 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens CLIP-associated protein 1 beta mRNA, partial cds. ACCESSION DQ200867 VERSION DQ200867.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 216) AUTHORS Maiato,H., Pontes,P., Sambade,C. and Earnshaw,W.C. TITLE CLASPs are distinct outer kinetochore proteins required for mitosis and associated with human cancers JOURNAL Unpublished REFERENCE 2 (bases 1 to 216) AUTHORS Maiato,H., Pontes,P., Sambade,C. and Earnshaw,W.C. TITLE Direct Submission JOURNAL Submitted (09-SEP-2005) Structural and Molecular Biology, Institute for Molecular and Cell Biology, Rua do Campo Alegre, 823, Porto 4150-180, Portugal FEATURES Location/Qualifiers source 1..216 /db_xref="H-InvDB:HIT000391775" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2q14.2-q14.3" CDS 1..>216 /note="CLASP1-beta; microtubule- and kinetochore-associated protein; required for bipolar spindle architecture" /codon_start=1 /product="CLIP-associated protein 1 beta" /protein_id="ABB13627.1" /translation="MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQ TMLDKLVDGLATSWVNSSNYKKNFDDED" BASE COUNT 63 a 42 c 59 g 52 t ORIGIN 1 atggagcctc gcatggagtc ctgcctggcg caggtgttgc agaaggatgt ggggaaacga 61 ttgcaggttg gccaagaact gatagactat ttctcagaca aacagaagtc tgctgacctt 121 gagcatgacc agaccatgtt agataaactt gtggatggac ttgctacctc ttgggtgaac 181 tctagcaatt acaagaaaaa tttcgacgat gaagat //