LOCUS       DQ187639                 340 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens donor 5 serotype PPS14 clone 3 immunoglobulin light
            chain variable region mRNA, partial cds.
ACCESSION   DQ187639
VERSION     DQ187639.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 340)
  AUTHORS   Shriner,A.K., Smithson,S.L., Rabquer,B., Khuder,S. and
            Westerink,M.A.
  TITLE     Analysis of the young and elderly variable gene repertoire in
            response to pneumococcal polysaccharides using a reconstituted SCID
            mouse model
  JOURNAL   Vaccine 24 (49-50), 7159-7166 (2006)
   PUBMED   16884837
REFERENCE   2  (bases 1 to 340)
  AUTHORS   Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J.
  TITLE     Differential variable gene usage between pneumococcal
            polysaccharide specific B cells isolated 5-10 days and 4-6 weeks
            post-vaccination
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 340)
  AUTHORS   Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-AUG-2005) Medicine, Medical University of Ohio, 3000
            Arlington Ave, Toledo, OH 43614, USA
FEATURES             Location/Qualifiers
     source          1..340
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /serotype="PPS14; pneumococcal polysaccharide 14"
                     /isolate="donor 5"
                     /isolation_source="6 weeks post-vaccination"
                     /db_xref="taxon:9606"
                     /clone="3"
     CDS             <1..>340
                     /codon_start=1
                     /product="immunoglobulin light chain variable region"
                     /protein_id="ABA26175.1"
                     /translation="DIEMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQ
                     KPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTRY
                     TFGQGTKLEIK"
BASE COUNT           86 a           93 c           85 g           76 t
ORIGIN      
        1 gacatcgaga tgacccagtc tccagactcc ctggctgtgt ctctgggcga gagggccacc
       61 atcaactgca agtccagcca gagtgtttta tacagctcca acaataagaa ctacttagct
      121 tggtaccagc agaaaccagg acagcctcct aagctgctca tttactgggc atctacccgg
      181 gaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc
      241 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaata ttatagtact
      301 cggtacactt ttggccaggg gaccaagctg gagatcaaac
//