LOCUS DQ187639 340 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens donor 5 serotype PPS14 clone 3 immunoglobulin light chain variable region mRNA, partial cds. ACCESSION DQ187639 VERSION DQ187639.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 340) AUTHORS Shriner,A.K., Smithson,S.L., Rabquer,B., Khuder,S. and Westerink,M.A. TITLE Analysis of the young and elderly variable gene repertoire in response to pneumococcal polysaccharides using a reconstituted SCID mouse model JOURNAL Vaccine 24 (49-50), 7159-7166 (2006) PUBMED 16884837 REFERENCE 2 (bases 1 to 340) AUTHORS Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J. TITLE Differential variable gene usage between pneumococcal polysaccharide specific B cells isolated 5-10 days and 4-6 weeks post-vaccination JOURNAL Unpublished REFERENCE 3 (bases 1 to 340) AUTHORS Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J. TITLE Direct Submission JOURNAL Submitted (31-AUG-2005) Medicine, Medical University of Ohio, 3000 Arlington Ave, Toledo, OH 43614, USA FEATURES Location/Qualifiers source 1..340 /organism="Homo sapiens" /mol_type="mRNA" /serotype="PPS14; pneumococcal polysaccharide 14" /isolate="donor 5" /isolation_source="6 weeks post-vaccination" /db_xref="taxon:9606" /clone="3" CDS <1..>340 /codon_start=1 /product="immunoglobulin light chain variable region" /protein_id="ABA26175.1" /translation="DIEMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQ KPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTRY TFGQGTKLEIK" BASE COUNT 86 a 93 c 85 g 76 t ORIGIN 1 gacatcgaga tgacccagtc tccagactcc ctggctgtgt ctctgggcga gagggccacc 61 atcaactgca agtccagcca gagtgtttta tacagctcca acaataagaa ctacttagct 121 tggtaccagc agaaaccagg acagcctcct aagctgctca tttactgggc atctacccgg 181 gaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc 241 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaata ttatagtact 301 cggtacactt ttggccaggg gaccaagctg gagatcaaac //