LOCUS       DQ187525                 340 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens donor 2 serotype PPS14 clone 21 immunoglobulin light
            chain variable region mRNA, partial cds.
ACCESSION   DQ187525
VERSION     DQ187525.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 340)
  AUTHORS   Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J.
  TITLE     Differential variable gene usage between pneumococcal
            polysaccharide specific B cells isolated 5-10 days and 4-6 weeks
            post-vaccination
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 340)
  AUTHORS   Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-AUG-2005) Medicine, Medical University of Ohio, 3000
            Arlington Ave, Toledo, OH 43614, USA
FEATURES             Location/Qualifiers
     source          1..340
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /serotype="PPS14; pneumococcal polysaccharide 14"
                     /isolate="donor 2"
                     /isolation_source="10 days post-vaccination"
                     /db_xref="taxon:9606"
                     /clone="21"
     CDS             <1..>340
                     /codon_start=1
                     /product="immunoglobulin light chain variable region"
                     /protein_id="ABA26061.1"
                     /translation="DILMTQSPDCPGCVSGREGHHQLQVQSECFIQLQQWELLAWYQQ
                     KPGQPPRLLINWASTRESGVTDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYETPC
                     TFGQGTKLEIK"
BASE COUNT           84 a           92 c           88 g           76 t
ORIGIN      
        1 gacatcctga tgacccagtc tccagactgc cctggctgtg tctctgggcg agagggccac
       61 catcaactgc aagtccagtc agagtgtttt atacagctcc aacaatggga actactagct
      121 tggtaccagc agaaaccagg acagcctcct aggctgctca ttaactgggc atctacccgg
      181 gaatccgggg tcactgaccg attcagtggc agcgggtctg ggacagattt cactctcacc
      241 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaata ttatgaaact
      301 ccgtgtactt ttggccaggg gaccaagctg gagatcaaac
//