LOCUS DQ187525 340 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens donor 2 serotype PPS14 clone 21 immunoglobulin light chain variable region mRNA, partial cds. ACCESSION DQ187525 VERSION DQ187525.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 340) AUTHORS Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J. TITLE Differential variable gene usage between pneumococcal polysaccharide specific B cells isolated 5-10 days and 4-6 weeks post-vaccination JOURNAL Unpublished REFERENCE 2 (bases 1 to 340) AUTHORS Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J. TITLE Direct Submission JOURNAL Submitted (31-AUG-2005) Medicine, Medical University of Ohio, 3000 Arlington Ave, Toledo, OH 43614, USA FEATURES Location/Qualifiers source 1..340 /organism="Homo sapiens" /mol_type="mRNA" /serotype="PPS14; pneumococcal polysaccharide 14" /isolate="donor 2" /isolation_source="10 days post-vaccination" /db_xref="taxon:9606" /clone="21" CDS <1..>340 /codon_start=1 /product="immunoglobulin light chain variable region" /protein_id="ABA26061.1" /translation="DILMTQSPDCPGCVSGREGHHQLQVQSECFIQLQQWELLAWYQQ KPGQPPRLLINWASTRESGVTDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYETPC TFGQGTKLEIK" BASE COUNT 84 a 92 c 88 g 76 t ORIGIN 1 gacatcctga tgacccagtc tccagactgc cctggctgtg tctctgggcg agagggccac 61 catcaactgc aagtccagtc agagtgtttt atacagctcc aacaatggga actactagct 121 tggtaccagc agaaaccagg acagcctcct aggctgctca ttaactgggc atctacccgg 181 gaatccgggg tcactgaccg attcagtggc agcgggtctg ggacagattt cactctcacc 241 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaata ttatgaaact 301 ccgtgtactt ttggccaggg gaccaagctg gagatcaaac //