LOCUS DQ187488 322 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens donor 1 serotype PPS14 clone 14 immunoglobulin light chain variable region mRNA, partial cds. ACCESSION DQ187488 VERSION DQ187488.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 322) AUTHORS Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J. TITLE Differential variable gene usage between pneumococcal polysaccharide specific B cells isolated 5-10 days and 4-6 weeks post-vaccination JOURNAL Unpublished REFERENCE 2 (bases 1 to 322) AUTHORS Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J. TITLE Direct Submission JOURNAL Submitted (31-AUG-2005) Medicine, Medical University of Ohio, 3000 Arlington Ave, Toledo, OH 43614, USA FEATURES Location/Qualifiers source 1..322 /db_xref="H-InvDB:HIT000342137" /organism="Homo sapiens" /mol_type="mRNA" /serotype="PPS14; pneumococcal polysaccharide 14" /isolate="donor 1" /isolation_source="10 days post-vaccination" /db_xref="taxon:9606" /clone="14" CDS <1..>322 /codon_start=1 /product="immunoglobulin light chain variable region" /protein_id="ABA26024.1" /translation="DIEMTQSPSSVSASVGDRVTITCRASQGISSYLAWYQQKPGKAP KLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFASYFCQQAKSFPLTFGGGT KVEME" BASE COUNT 79 a 83 c 84 g 76 t ORIGIN 1 gacatcgaga tgacccagtc tccatcttct gtgtctgcat ctgtaggaga cagagtcacc 61 atcacttgtc gggcgagtca gggtattagc agctacttag cctggtatca gcagaaacca 121 gggaaagccc ccaaactcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca 181 cggttcagcg gcagtggatc tgggacagat ttcactctca ctatcagcag cctgcagcct 241 gaagattttg caagttactt ttgtcaacag gcaaagagtt tcccgctcac tttcggcgga 301 gggaccaagg tggagatgga ac //