LOCUS       DQ187488                 322 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens donor 1 serotype PPS14 clone 14 immunoglobulin light
            chain variable region mRNA, partial cds.
ACCESSION   DQ187488
VERSION     DQ187488.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 322)
  AUTHORS   Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J.
  TITLE     Differential variable gene usage between pneumococcal
            polysaccharide specific B cells isolated 5-10 days and 4-6 weeks
            post-vaccination
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 322)
  AUTHORS   Rabquer,B.J., Smithson,S.L., Shriner,A.K. and Westerink,M.A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-AUG-2005) Medicine, Medical University of Ohio, 3000
            Arlington Ave, Toledo, OH 43614, USA
FEATURES             Location/Qualifiers
     source          1..322
                     /db_xref="H-InvDB:HIT000342137"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /serotype="PPS14; pneumococcal polysaccharide 14"
                     /isolate="donor 1"
                     /isolation_source="10 days post-vaccination"
                     /db_xref="taxon:9606"
                     /clone="14"
     CDS             <1..>322
                     /codon_start=1
                     /product="immunoglobulin light chain variable region"
                     /protein_id="ABA26024.1"
                     /translation="DIEMTQSPSSVSASVGDRVTITCRASQGISSYLAWYQQKPGKAP
                     KLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFASYFCQQAKSFPLTFGGGT
                     KVEME"
BASE COUNT           79 a           83 c           84 g           76 t
ORIGIN      
        1 gacatcgaga tgacccagtc tccatcttct gtgtctgcat ctgtaggaga cagagtcacc
       61 atcacttgtc gggcgagtca gggtattagc agctacttag cctggtatca gcagaaacca
      121 gggaaagccc ccaaactcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
      181 cggttcagcg gcagtggatc tgggacagat ttcactctca ctatcagcag cctgcagcct
      241 gaagattttg caagttactt ttgtcaacag gcaaagagtt tcccgctcac tttcggcgga
      301 gggaccaagg tggagatgga ac
//