LOCUS DQ185045 173 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens microsomal glutathione S-transferase 3 mRNA, partial cds. ACCESSION DQ185045 VERSION DQ185045.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 173) AUTHORS Kobayashi,K., Xin,Y., Ymer,S.I., Werther,G.A. and Russo,V.C. TITLE Subtractive hybridisation screen identifies genes regulated by glucose deprivation in human neuroblastoma cells JOURNAL Brain Res. 1170, 129-139 (2007) PUBMED 17719568 REFERENCE 2 (bases 1 to 173) AUTHORS Kobayashi,K., Ying,X., Ymer,S.I., Werther,G.A. and Russo,V.C. TITLE Gene expression profile in neuroblastoma cells exposed to glucose stress JOURNAL Unpublished REFERENCE 3 (bases 1 to 173) AUTHORS Russo,V.C., Kobayashi,K. and Werther,G.A. TITLE Direct Submission JOURNAL Submitted (24-AUG-2005) Centre for Hormone Research, Murdoch Childrens Institute, Royal Children's Hospital, Flemington Road, Parkville, VIC 3052, Australia FEATURES Location/Qualifiers source 1..173 /db_xref="H-InvDB:HIT000342127" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 66..>173 /note="MGST3" /codon_start=1 /product="microsomal glutathione S-transferase 3" /protein_id="ABD14425.1" /translation="MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKY" misc_feature 147..158 /note="N-glycosylation site; ASN-glycosylation" BASE COUNT 36 a 49 c 42 g 46 t ORIGIN 1 cgcacccaca ccgcgctgcg cagttttgtt ctgctccagc tgttcgaagg tgatccagac 61 gcaagatggc tgtcctctct aaggaatatg gttttgtgct tctaactggt gctgccagct 121 ttataatggt ggcccaccta gccatcaatg tttccaaggc ccgcaagaag tac //