LOCUS       DQ185045                 173 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens microsomal glutathione S-transferase 3 mRNA, partial
            cds.
ACCESSION   DQ185045
VERSION     DQ185045.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 173)
  AUTHORS   Kobayashi,K., Xin,Y., Ymer,S.I., Werther,G.A. and Russo,V.C.
  TITLE     Subtractive hybridisation screen identifies genes regulated by
            glucose deprivation in human neuroblastoma cells
  JOURNAL   Brain Res. 1170, 129-139 (2007)
   PUBMED   17719568
REFERENCE   2  (bases 1 to 173)
  AUTHORS   Kobayashi,K., Ying,X., Ymer,S.I., Werther,G.A. and Russo,V.C.
  TITLE     Gene expression profile in neuroblastoma cells exposed to glucose
            stress
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 173)
  AUTHORS   Russo,V.C., Kobayashi,K. and Werther,G.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-AUG-2005) Centre for Hormone Research, Murdoch
            Childrens Institute, Royal Children's Hospital, Flemington Road,
            Parkville, VIC 3052, Australia
FEATURES             Location/Qualifiers
     source          1..173
                     /db_xref="H-InvDB:HIT000342127"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             66..>173
                     /note="MGST3"
                     /codon_start=1
                     /product="microsomal glutathione S-transferase 3"
                     /protein_id="ABD14425.1"
                     /translation="MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKY"
     misc_feature    147..158
                     /note="N-glycosylation site; ASN-glycosylation"
BASE COUNT           36 a           49 c           42 g           46 t
ORIGIN      
        1 cgcacccaca ccgcgctgcg cagttttgtt ctgctccagc tgttcgaagg tgatccagac
       61 gcaagatggc tgtcctctct aaggaatatg gttttgtgct tctaactggt gctgccagct
      121 ttataatggt ggcccaccta gccatcaatg tttccaaggc ccgcaagaag tac
//