LOCUS DQ185040 262 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens eukaryotic translation elongation factor 1 gamma mRNA, partial cds. ACCESSION DQ185040 VERSION DQ185040.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 262) AUTHORS Kobayashi,K., Xin,Y., Ymer,S.I., Werther,G.A. and Russo,V.C. TITLE Subtractive hybridisation screen identifies genes regulated by glucose deprivation in human neuroblastoma cells JOURNAL Brain Res. 1170, 129-139 (2007) PUBMED 17719568 REFERENCE 2 (bases 1 to 262) AUTHORS Kobayashi,K., Ying,X., Ymer,S.I., Werther,G.A. and Russo,V.C. TITLE Gene expression profile in neuroblastoma cells exposed to glucose stress JOURNAL Unpublished REFERENCE 3 (bases 1 to 262) AUTHORS Russo,V.C., Kobayashi,K. and Werther,G.A. TITLE Direct Submission JOURNAL Submitted (24-AUG-2005) Centre for Hormone Research, Murdoch Childrens Institute, Royal Children's Hospital, Flemington Road, Parkville, VIC 3052, Australia FEATURES Location/Qualifiers source 1..262 /db_xref="H-InvDB:HIT000342122" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS <1..>262 /note="EEF1G; plays role in anchoring complex to other cellular components" /codon_start=3 /product="eukaryotic translation elongation factor 1 gamma" /protein_id="ABD14420.1" /translation="AAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNR TPEFLHKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGST" misc_feature 3..>262 /note="Region: GST-like domain" BASE COUNT 55 a 77 c 70 g 60 t ORIGIN 1 tggcggctgg gaccctgtac acgtatcctg aaaactggag ggccttcaag gctctcatcg 61 ctgctcagta cagcggggct caggtccgcg tgctctccgc accaccccac ttccattttg 121 gccaaaccaa ccgcacccct gaatttctcc acaaatttcc tgccggcaag gtcccagcat 181 ttgagggtga tgatggattc tgtgtgtttg agagcaacgc cattgcctac tatgtgagca 241 atgaggagct gcggggaagt ac //