LOCUS       DQ185040                 262 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens eukaryotic translation elongation factor 1 gamma mRNA,
            partial cds.
ACCESSION   DQ185040
VERSION     DQ185040.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 262)
  AUTHORS   Kobayashi,K., Xin,Y., Ymer,S.I., Werther,G.A. and Russo,V.C.
  TITLE     Subtractive hybridisation screen identifies genes regulated by
            glucose deprivation in human neuroblastoma cells
  JOURNAL   Brain Res. 1170, 129-139 (2007)
   PUBMED   17719568
REFERENCE   2  (bases 1 to 262)
  AUTHORS   Kobayashi,K., Ying,X., Ymer,S.I., Werther,G.A. and Russo,V.C.
  TITLE     Gene expression profile in neuroblastoma cells exposed to glucose
            stress
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 262)
  AUTHORS   Russo,V.C., Kobayashi,K. and Werther,G.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-AUG-2005) Centre for Hormone Research, Murdoch
            Childrens Institute, Royal Children's Hospital, Flemington Road,
            Parkville, VIC 3052, Australia
FEATURES             Location/Qualifiers
     source          1..262
                     /db_xref="H-InvDB:HIT000342122"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..>262
                     /note="EEF1G; plays role in anchoring complex to other
                     cellular components"
                     /codon_start=3
                     /product="eukaryotic translation elongation factor 1
                     gamma"
                     /protein_id="ABD14420.1"
                     /translation="AAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNR
                     TPEFLHKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGST"
     misc_feature    3..>262
                     /note="Region: GST-like domain"
BASE COUNT           55 a           77 c           70 g           60 t
ORIGIN      
        1 tggcggctgg gaccctgtac acgtatcctg aaaactggag ggccttcaag gctctcatcg
       61 ctgctcagta cagcggggct caggtccgcg tgctctccgc accaccccac ttccattttg
      121 gccaaaccaa ccgcacccct gaatttctcc acaaatttcc tgccggcaag gtcccagcat
      181 ttgagggtga tgatggattc tgtgtgtttg agagcaacgc cattgcctac tatgtgagca
      241 atgaggagct gcggggaagt ac
//