LOCUS       DQ088983                 463 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens MYO9 isoform 1 mRNA, partial cds.
ACCESSION   DQ088983
VERSION     DQ088983.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 463)
  AUTHORS   Hiller,M., Huse,K., Platzer,M. and Backofen,R.
  TITLE     Non-EST based prediction of exon skipping and intron retention
            events using Pfam information
  JOURNAL   Nucleic Acids Res. 33 (17), 5611-5621 (2005)
   PUBMED   16204458
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 463)
  AUTHORS   Huse,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2005) Genome Analysis, Institute of Molecular
            Biotechnology, Beutenbergstr.11, Jena 07745, Germany
FEATURES             Location/Qualifiers
     source          1..463
                     /db_xref="H-InvDB:HIT000341101"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..>463
                     /codon_start=2
                     /product="MYO9 isoform 1"
                     /protein_id="AAZ85978.1"
                     /translation="NSSRFGKFIQVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNY
                     HVFYYLLAGASEDERSAFHLKQPEEYHYLNQITKKPLRQSWDDYCYDSEPDCFTVEGE
                     DLRHDFERLQLAMEMVGFLPKTRRQIFSLLSAILHLGNICYKKKTYRDDSID"
BASE COUNT          148 a           92 c           99 g          124 t
ORIGIN      
        1 caattcaagt cgttttggga agtttattca agtaaattac caggaaacag gcactgtact
       61 tggtgcctat gttgaaaaat atctactgga gaagtccaga ctcgtttatc aggagcataa
      121 tgaacggaac tatcatgtat tctattacct cctggcagga gcaagtgaag atgagagatc
      181 agcattccat cttaagcaac cagaggaata tcattatctc aatcagataa caaagaaacc
      241 cctcagacag agctgggatg attattgcta tgactctgag ccggattgct tcacggtgga
      301 aggagaagat ttgagacatg actttgagcg cctacaactt gccatggaaa tggtaggatt
      361 tcttcccaag acacgaagac agattttctc tcttctctca gccatactac atttgggtaa
      421 tatctgttac aaaaagaaga cataccggga tgactccatt gat
//