LOCUS DQ088983 463 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens MYO9 isoform 1 mRNA, partial cds. ACCESSION DQ088983 VERSION DQ088983.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 463) AUTHORS Hiller,M., Huse,K., Platzer,M. and Backofen,R. TITLE Non-EST based prediction of exon skipping and intron retention events using Pfam information JOURNAL Nucleic Acids Res. 33 (17), 5611-5621 (2005) PUBMED 16204458 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 463) AUTHORS Huse,K. TITLE Direct Submission JOURNAL Submitted (08-JUN-2005) Genome Analysis, Institute of Molecular Biotechnology, Beutenbergstr.11, Jena 07745, Germany FEATURES Location/Qualifiers source 1..463 /db_xref="H-InvDB:HIT000341101" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS <1..>463 /codon_start=2 /product="MYO9 isoform 1" /protein_id="AAZ85978.1" /translation="NSSRFGKFIQVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNY HVFYYLLAGASEDERSAFHLKQPEEYHYLNQITKKPLRQSWDDYCYDSEPDCFTVEGE DLRHDFERLQLAMEMVGFLPKTRRQIFSLLSAILHLGNICYKKKTYRDDSID" BASE COUNT 148 a 92 c 99 g 124 t ORIGIN 1 caattcaagt cgttttggga agtttattca agtaaattac caggaaacag gcactgtact 61 tggtgcctat gttgaaaaat atctactgga gaagtccaga ctcgtttatc aggagcataa 121 tgaacggaac tatcatgtat tctattacct cctggcagga gcaagtgaag atgagagatc 181 agcattccat cttaagcaac cagaggaata tcattatctc aatcagataa caaagaaacc 241 cctcagacag agctgggatg attattgcta tgactctgag ccggattgct tcacggtgga 301 aggagaagat ttgagacatg actttgagcg cctacaactt gccatggaaa tggtaggatt 361 tcttcccaag acacgaagac agattttctc tcttctctca gccatactac atttgggtaa 421 tatctgttac aaaaagaaga cataccggga tgactccatt gat //