LOCUS       DQ067452                 687 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens diaphanous-1 (DIAPH1) mRNA, partial cds.
ACCESSION   DQ067452
VERSION     DQ067452.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 687)
  AUTHORS   Hudson,B.I., Kalea,A.Z., Del Mar Arriero,M., Harja,E.,
            Boulanger,E., D'Agati,V. and Schmidt,A.M.
  TITLE     Interaction of the RAGE cytoplasmic domain with diaphanous-1 is
            required for ligand-stimulated cellular migration through
            activation of Rac1 and Cdc42
  JOURNAL   J. Biol. Chem. 283 (49), 34457-34468 (2008)
   PUBMED   18922799
REFERENCE   2  (bases 1 to 687)
  AUTHORS   Hudson,B.I., Arriero,M. and Schmidt,A.M.
  TITLE     The Cytoplasmic Domain of RAGE Interacts with Diaphanous-1: a
            Mechanism to Bridge Signal Transduction & Cellular Migration
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 687)
  AUTHORS   Hudson,B.I., Arriero,M. and Schmidt,A.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2005) Surgery, Columbia University, 630 W 168th
            St, P&S 17-501, New York, NY 10032, USA
FEATURES             Location/Qualifiers
     source          1..687
                     /db_xref="H-InvDB:HIT000391712"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q31"
                     /tissue_type="lung"
                     /note="yeast 2 hybrid system clone"
     gene            <1..>687
                     /gene="DIAPH1"
                     /gene_synonym="DFNA1"
                     /gene_synonym="hDIA1"
                     /gene_synonym="LFHL1"
     CDS             <1..>687
                     /gene="DIAPH1"
                     /gene_synonym="DFNA1"
                     /gene_synonym="hDIA1"
                     /gene_synonym="LFHL1"
                     /note="DRF1; contains FH1 domain; identified from yeast
                     two-hybrid to interact with the cytosolic domain of RAGE"
                     /codon_start=1
                     /product="diaphanous-1"
                     /protein_id="AAZ23039.1"
                     /translation="PPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEG
                     VGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPP
                     PLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPE
                     VQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEG
                     GEEKKSVQKKK"
BASE COUNT          137 a          245 c          139 g          166 t
ORIGIN      
        1 cctccacctc ctttgcctgg gggtgtttgc atctcctcac ccccttcttt acctggaggt
       61 actgctatct ctccaccccc tcctttgtct ggggatgcta ccatccctcc accccctcct
      121 ttgcctgagg gtgttggcat cccttcaccc tcttctttgc ctggaggtac tgccatcccc
      181 ccacctcctc ctttgcctgg gagtgctaga atccccccac caccacctcc tttgcctggg
      241 agtgctggaa ttcccccccc acctcctccc ttgcctggag aagcaggaat gccacctcct
      301 cctccccctc ttcctggtgg tcctggaatc cctccacctc ctccatttcc cggaggccct
      361 ggcattcctc cacctccacc cggaatgggt atgcctccac ctcccccatt tggatttgga
      421 gttcctgcag ccccagttct gccatttgga ttaaccccca aaaagcttta taagccagag
      481 gtgcagctcc ggaggccaaa ctggtccaag cttgtggctg aggacctctc ccaggactgc
      541 ttctggacaa aggtgaagga ggaccgcttt gagaacaatg aacttttcgc caaacttacc
      601 cttaccttct ctgcccagac caagacttcc aaagccaaga aggatcaaga aggtggagaa
      661 gaaaagaaat ctgtgcaaaa aaaaaaa
//