LOCUS DQ067452 687 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens diaphanous-1 (DIAPH1) mRNA, partial cds. ACCESSION DQ067452 VERSION DQ067452.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 687) AUTHORS Hudson,B.I., Kalea,A.Z., Del Mar Arriero,M., Harja,E., Boulanger,E., D'Agati,V. and Schmidt,A.M. TITLE Interaction of the RAGE cytoplasmic domain with diaphanous-1 is required for ligand-stimulated cellular migration through activation of Rac1 and Cdc42 JOURNAL J. Biol. Chem. 283 (49), 34457-34468 (2008) PUBMED 18922799 REFERENCE 2 (bases 1 to 687) AUTHORS Hudson,B.I., Arriero,M. and Schmidt,A.M. TITLE The Cytoplasmic Domain of RAGE Interacts with Diaphanous-1: a Mechanism to Bridge Signal Transduction & Cellular Migration JOURNAL Unpublished REFERENCE 3 (bases 1 to 687) AUTHORS Hudson,B.I., Arriero,M. and Schmidt,A.M. TITLE Direct Submission JOURNAL Submitted (17-MAY-2005) Surgery, Columbia University, 630 W 168th St, P&S 17-501, New York, NY 10032, USA FEATURES Location/Qualifiers source 1..687 /db_xref="H-InvDB:HIT000391712" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="5" /map="5q31" /tissue_type="lung" /note="yeast 2 hybrid system clone" gene <1..>687 /gene="DIAPH1" /gene_synonym="DFNA1" /gene_synonym="hDIA1" /gene_synonym="LFHL1" CDS <1..>687 /gene="DIAPH1" /gene_synonym="DFNA1" /gene_synonym="hDIA1" /gene_synonym="LFHL1" /note="DRF1; contains FH1 domain; identified from yeast two-hybrid to interact with the cytosolic domain of RAGE" /codon_start=1 /product="diaphanous-1" /protein_id="AAZ23039.1" /translation="PPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEG VGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPP PLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPE VQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEG GEEKKSVQKKK" BASE COUNT 137 a 245 c 139 g 166 t ORIGIN 1 cctccacctc ctttgcctgg gggtgtttgc atctcctcac ccccttcttt acctggaggt 61 actgctatct ctccaccccc tcctttgtct ggggatgcta ccatccctcc accccctcct 121 ttgcctgagg gtgttggcat cccttcaccc tcttctttgc ctggaggtac tgccatcccc 181 ccacctcctc ctttgcctgg gagtgctaga atccccccac caccacctcc tttgcctggg 241 agtgctggaa ttcccccccc acctcctccc ttgcctggag aagcaggaat gccacctcct 301 cctccccctc ttcctggtgg tcctggaatc cctccacctc ctccatttcc cggaggccct 361 ggcattcctc cacctccacc cggaatgggt atgcctccac ctcccccatt tggatttgga 421 gttcctgcag ccccagttct gccatttgga ttaaccccca aaaagcttta taagccagag 481 gtgcagctcc ggaggccaaa ctggtccaag cttgtggctg aggacctctc ccaggactgc 541 ttctggacaa aggtgaagga ggaccgcttt gagaacaatg aacttttcgc caaacttacc 601 cttaccttct ctgcccagac caagacttcc aaagccaaga aggatcaaga aggtggagaa 661 gaaaagaaat ctgtgcaaaa aaaaaaa //