LOCUS       D45213                   555 bp    mRNA    linear   HUM 23-SEP-2006
DEFINITION  Homo sapiens mRNA for zinc finger protein, complete cds.
ACCESSION   D45213
VERSION     D45213.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 555)
  AUTHORS   Terunuma,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-1995) to the DDBJ/EMBL/GenBank databases.
            Contact:Atsushi Terunuma
            Cancer Institute, Japanese Foundation For Cancer Research, Cell
            Biology; Kami-Ikebukuro 1-37-1, Toshima-ku, Tokyo 170, Japan
REFERENCE   2
  AUTHORS   Terunuma,A., Shiba,K. and Noda,T.
  TITLE     A novel genetic system to isolate a dominant negative effector on
            DNA-binding activity of Oct-2
  JOURNAL   Nucleic Acids Res. 25, 1984-1990 (1997)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..555
                     /cell_line="KUT-2"
                     /cell_type="T-cell"
                     /clone="hT86"
                     /clone_lib="K.Shigesada"
                     /db_xref="H-InvDB:HIT000101489"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /tissue_type="lymphoma"
     CDS             51..401
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="BAA20369.1"
                     /translation="MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHR
                     CLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVP
                     TEVSTEVPEMDTST"
     regulatory      535..540
                     /regulatory_class="polyA_signal_sequence"
     polyA_site      555
BASE COUNT          120 a          173 c          179 g           83 t
ORIGIN      
        1 gtcgctcccg ccggacaggc gcgcaccgag cgcactctct agcccggcag atgaaggcga
       61 agcggcggcg gccggacttg gatgagattc accgcgagct gcggcctcag ggatccgcac
      121 gaccccagcc cgacccaaac gccgagttcg accccgacct gccagggggc ggcctgcacc
      181 gctgtctggc ctgcgcgagg tacttcatcg attccaccaa cctgaagacc cacttccgat
      241 ccaaagacca caagaaaagg ctgaagcagc tgagcgtcga gccctacagt caggaagagg
      301 cggagagggc agcgggtatg ggatcctatg tgccccccag gcggctggca gtgcccacgg
      361 aagtgtccac tgaggtccct gagatggata cctctacctg acatggcctg aagatgcagg
      421 gcagaggaat tgcccatgga cagtgacgca aggactaggc tgggagggag cgtgccaacc
      481 ccttttgcct ctgggtttgg ggagcggagg gcctcttctt ggtgccctgc ccccaataaa
      541 ggaactggac aaaga
//