LOCUS D45213 555 bp mRNA linear HUM 23-SEP-2006 DEFINITION Homo sapiens mRNA for zinc finger protein, complete cds. ACCESSION D45213 VERSION D45213.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 555) AUTHORS Terunuma,A. TITLE Direct Submission JOURNAL Submitted (20-JAN-1995) to the DDBJ/EMBL/GenBank databases. Contact:Atsushi Terunuma Cancer Institute, Japanese Foundation For Cancer Research, Cell Biology; Kami-Ikebukuro 1-37-1, Toshima-ku, Tokyo 170, Japan REFERENCE 2 AUTHORS Terunuma,A., Shiba,K. and Noda,T. TITLE A novel genetic system to isolate a dominant negative effector on DNA-binding activity of Oct-2 JOURNAL Nucleic Acids Res. 25, 1984-1990 (1997) COMMENT FEATURES Location/Qualifiers source 1..555 /cell_line="KUT-2" /cell_type="T-cell" /clone="hT86" /clone_lib="K.Shigesada" /db_xref="H-InvDB:HIT000101489" /db_xref="taxon:9606" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="lymphoma" CDS 51..401 /codon_start=1 /product="zinc finger protein" /protein_id="BAA20369.1" /translation="MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHR CLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVP TEVSTEVPEMDTST" regulatory 535..540 /regulatory_class="polyA_signal_sequence" polyA_site 555 BASE COUNT 120 a 173 c 179 g 83 t ORIGIN 1 gtcgctcccg ccggacaggc gcgcaccgag cgcactctct agcccggcag atgaaggcga 61 agcggcggcg gccggacttg gatgagattc accgcgagct gcggcctcag ggatccgcac 121 gaccccagcc cgacccaaac gccgagttcg accccgacct gccagggggc ggcctgcacc 181 gctgtctggc ctgcgcgagg tacttcatcg attccaccaa cctgaagacc cacttccgat 241 ccaaagacca caagaaaagg ctgaagcagc tgagcgtcga gccctacagt caggaagagg 301 cggagagggc agcgggtatg ggatcctatg tgccccccag gcggctggca gtgcccacgg 361 aagtgtccac tgaggtccct gagatggata cctctacctg acatggcctg aagatgcagg 421 gcagaggaat tgcccatgga cagtgacgca aggactaggc tgggagggag cgtgccaacc 481 ccttttgcct ctgggtttgg ggagcggagg gcctcttctt ggtgccctgc ccccaataaa 541 ggaactggac aaaga //