LOCUS HUMPYYP3 719 bp mRNA linear HUM 01-AUG-2002 DEFINITION Homo sapiens mRNA for peptide YY, complete cds. ACCESSION D13902 VERSION D13902.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 719) AUTHORS Kohri,K. TITLE Direct Submission JOURNAL Submitted (09-DEC-1992) to the DDBJ/EMBL/GenBank databases. Contact:Kazuhiro Kohri Tohoku University School of Medicine, Department of Biochemistry; 2-1 Seiryou-machi, Aoba-ku, Sendai, Miyagi 980, Japan REFERENCE 2 AUTHORS Kohri,K., Nata,K., Yonekura,H., Nagai,A., Konno,K. and Okamoto,H. TITLE Cloning and structural determination of human peptide YY cDNA and gene JOURNAL Biochim. Biophys. Acta 1173, 345-349 (1993) COMMENT FEATURES Location/Qualifiers source 1..719 /clone="gES-6" /db_xref="H-InvDB:HIT000100526" /db_xref="taxon:9606" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="colon" 5'UTR 1..82 CDS 83..355 /codon_start=1 /note="preproPYY" /product="peptide YY precursor" /protein_id="BAA03002.1" /translation="MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEE LNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGEDRPVRSR" sig_peptide 83..166 mat_peptide 167..274 /note="PYY" /product="peptide YY" variation 297 /replace="g" 3'UTR 356..719 variation 419 /replace="c" variation 653 /replace="c" regulatory 699..704 /regulatory_class="polyA_signal_sequence" BASE COUNT 119 a 273 c 192 g 135 t ORIGIN 1 ctcagcttga cctgcggcag tgcagccctt gggacttccc tcgccttcca cctcctgctc 61 gtctgcttca caagctatcg ctatggtgtt cgtgcgcagg ccgtggcccg ccttgaccac 121 agtgcttctg gccctgctcg tctgcctagg ggcgctggtc gacgcctacc ccatcaaacc 181 cgaggctccc ggcgaagacg cctcgccgga ggagctgaac cgctactacg cctccctgcg 241 ccactacctc aacctggtca cccggcagcg gtatgggaaa agagacggcc cggacacgct 301 tctttccaaa acgttcttcc ccgacggcga ggaccgcccc gtcaggtcgc ggtaaaagcg 361 cccgttacca cacatcctgc atccgagagc gcggcctggc cctaccctgg caacatcatt 421 taacgacgtc tcccaggctc gcctccccag atccaattcc ttccccttcg cttccgcagg 481 tcggagggcc cagacctgtg gtgaggaccc ctgaggcctc ctgggagatc tgccaaccac 541 gcccacgtca tttgcatacg cactcccgac cccagaaacc cggattctgc ctcccgacgg 601 cggcgtctgg gcagggttcg ggtgcggccc tccgcccgcg tctcggtgcc ccagccccct 661 gggctggagg gctgtgtgtg gtccttccct ggtcccaaaa taaagagcaa attccacag //