LOCUS       HUMPYYP3                 719 bp    mRNA    linear   HUM 01-AUG-2002
DEFINITION  Homo sapiens mRNA for peptide YY, complete cds.
ACCESSION   D13902
VERSION     D13902.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 719)
  AUTHORS   Kohri,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-DEC-1992) to the DDBJ/EMBL/GenBank databases.
            Contact:Kazuhiro Kohri
            Tohoku University School of Medicine, Department of Biochemistry;
            2-1 Seiryou-machi, Aoba-ku, Sendai, Miyagi 980, Japan
REFERENCE   2
  AUTHORS   Kohri,K., Nata,K., Yonekura,H., Nagai,A., Konno,K. and Okamoto,H.
  TITLE     Cloning and structural determination of human peptide YY cDNA and
            gene
  JOURNAL   Biochim. Biophys. Acta 1173, 345-349 (1993)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..719
                     /clone="gES-6"
                     /db_xref="H-InvDB:HIT000100526"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /tissue_type="colon"
     5'UTR           1..82
     CDS             83..355
                     /codon_start=1
                     /note="preproPYY"
                     /product="peptide YY precursor"
                     /protein_id="BAA03002.1"
                     /translation="MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEE
                     LNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGEDRPVRSR"
     sig_peptide     83..166
     mat_peptide     167..274
                     /note="PYY"
                     /product="peptide YY"
     variation       297
                     /replace="g"
     3'UTR           356..719
     variation       419
                     /replace="c"
     variation       653
                     /replace="c"
     regulatory      699..704
                     /regulatory_class="polyA_signal_sequence"
BASE COUNT          119 a          273 c          192 g          135 t
ORIGIN      
        1 ctcagcttga cctgcggcag tgcagccctt gggacttccc tcgccttcca cctcctgctc
       61 gtctgcttca caagctatcg ctatggtgtt cgtgcgcagg ccgtggcccg ccttgaccac
      121 agtgcttctg gccctgctcg tctgcctagg ggcgctggtc gacgcctacc ccatcaaacc
      181 cgaggctccc ggcgaagacg cctcgccgga ggagctgaac cgctactacg cctccctgcg
      241 ccactacctc aacctggtca cccggcagcg gtatgggaaa agagacggcc cggacacgct
      301 tctttccaaa acgttcttcc ccgacggcga ggaccgcccc gtcaggtcgc ggtaaaagcg
      361 cccgttacca cacatcctgc atccgagagc gcggcctggc cctaccctgg caacatcatt
      421 taacgacgtc tcccaggctc gcctccccag atccaattcc ttccccttcg cttccgcagg
      481 tcggagggcc cagacctgtg gtgaggaccc ctgaggcctc ctgggagatc tgccaaccac
      541 gcccacgtca tttgcatacg cactcccgac cccagaaacc cggattctgc ctcccgacgg
      601 cggcgtctgg gcagggttcg ggtgcggccc tccgcccgcg tctcggtgcc ccagccccct
      661 gggctggagg gctgtgtgtg gtccttccct ggtcccaaaa taaagagcaa attccacag
//