LOCUS       CR542286                1014 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0127D for
            gene SCAMP1, secretory carrier membrane protein 1; complete cds,
            without stopcodon.
ACCESSION   CR542286
VERSION     CR542286.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1014)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1014)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0127D, ORFNo 5121
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0127D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131062.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BC015065
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1014
                     /db_xref="H-InvDB:HIT000269153"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0127D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>1014
                     /codon_start=1
                     /gene="SCAMP1"
                     /db_xref="GOA:O15126"
                     /db_xref="H-InvDB:HIT000269153.12"
                     /db_xref="HGNC:HGNC:10563"
                     /db_xref="InterPro:IPR007273"
                     /db_xref="UniProtKB/Swiss-Prot:O15126"
                     /protein_id="CAG47081.1"
                     /translation="MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSR
                     TPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELD
                     RREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHA
                     VTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRF
                     FVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAV
                     ISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFK
                     GNQI"
BASE COUNT          292 a          221 c          206 g          295 t
ORIGIN      
        1 atgtcggatt tcgacagtaa cccgtttgcc gacccggatc tcaacaatcc cttcaaggat
       61 ccatcagtta cacaagtgac aagaaatgtt ccaccaggac ttgatgaata taatccattc
      121 tcggattcta gaacacctcc accaggcggt gtgaagatgc ctaatgtacc caatacacaa
      181 ccagcaataa tgaaaccaac agaggaacat ccagcttata cacagattgc aaaggaacat
      241 gcattggccc aagctgaact tcttaagcgc caggaagaac tagaaagaaa agccgcagaa
      301 ttagatcgtc gggaacgaga aatgcaaaac ctcagtcaac atggtagaaa aaataattgg
      361 ccacctcttc ctagcaattt tcctgtcgga ccttgtttct atcaggattt ttctgtagac
      421 attcctgtag aattccaaaa gacagtaaag cttatgtact acttgtggat gttccatgca
      481 gtaacactgt ttctaaatat cttcggatgc ttggcttggt tttgtgttga ttctgcaaga
      541 gcggttgatt ttggattgag tatcctgtgg ttcttgcttt ttactccttg ttcatttgtc
      601 tgttggtaca gaccacttta tggagctttc aggagtgaca gttcatttag attctttgta
      661 ttcttcttcg tctatatttg tcagtttgct gtacatgtac tccaagctgc aggatttcat
      721 aactggggca attgtggttg gatttcatcc cttactggtc tcaaccaaaa tattcctgtt
      781 ggaatcatga tgataatcat agcagcactt ttcacagcat cagcagtcat ctcactagtt
      841 atgttcaaaa aagtacatgg actatatcgc acaacaggtg ctagttttga gaaggcccaa
      901 caggagtttg caacaggtgt gatgtccaac aaaactgtcc agaccgcagc tgcaaatgca
      961 gcttcaactg cagcatctag tgcagctcag aatgctttca agggtaacca gatt
//