LOCUS CR542286 1014 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0127D for gene SCAMP1, secretory carrier membrane protein 1; complete cds, without stopcodon. ACCESSION CR542286 VERSION CR542286.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1014) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1014) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0127D, ORFNo 5121 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0127D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131062.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence BC015065 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1014 /db_xref="H-InvDB:HIT000269153" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0127D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>1014 /codon_start=1 /gene="SCAMP1" /db_xref="GOA:O15126" /db_xref="H-InvDB:HIT000269153.12" /db_xref="HGNC:HGNC:10563" /db_xref="InterPro:IPR007273" /db_xref="UniProtKB/Swiss-Prot:O15126" /protein_id="CAG47081.1" /translation="MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSR TPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELD RREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHA VTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRF FVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAV ISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFK GNQI" BASE COUNT 292 a 221 c 206 g 295 t ORIGIN 1 atgtcggatt tcgacagtaa cccgtttgcc gacccggatc tcaacaatcc cttcaaggat 61 ccatcagtta cacaagtgac aagaaatgtt ccaccaggac ttgatgaata taatccattc 121 tcggattcta gaacacctcc accaggcggt gtgaagatgc ctaatgtacc caatacacaa 181 ccagcaataa tgaaaccaac agaggaacat ccagcttata cacagattgc aaaggaacat 241 gcattggccc aagctgaact tcttaagcgc caggaagaac tagaaagaaa agccgcagaa 301 ttagatcgtc gggaacgaga aatgcaaaac ctcagtcaac atggtagaaa aaataattgg 361 ccacctcttc ctagcaattt tcctgtcgga ccttgtttct atcaggattt ttctgtagac 421 attcctgtag aattccaaaa gacagtaaag cttatgtact acttgtggat gttccatgca 481 gtaacactgt ttctaaatat cttcggatgc ttggcttggt tttgtgttga ttctgcaaga 541 gcggttgatt ttggattgag tatcctgtgg ttcttgcttt ttactccttg ttcatttgtc 601 tgttggtaca gaccacttta tggagctttc aggagtgaca gttcatttag attctttgta 661 ttcttcttcg tctatatttg tcagtttgct gtacatgtac tccaagctgc aggatttcat 721 aactggggca attgtggttg gatttcatcc cttactggtc tcaaccaaaa tattcctgtt 781 ggaatcatga tgataatcat agcagcactt ttcacagcat cagcagtcat ctcactagtt 841 atgttcaaaa aagtacatgg actatatcgc acaacaggtg ctagttttga gaaggcccaa 901 caggagtttg caacaggtgt gatgtccaac aaaactgtcc agaccgcagc tgcaaatgca 961 gcttcaactg cagcatctag tgcagctcag aatgctttca agggtaacca gatt //