LOCUS CR542285 981 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H1226D for gene PPP1CB, protein phosphatase 1, catalytic subunit, beta isoform; complete cds, without stopcodon. ACCESSION CR542285 VERSION CR542285.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 981) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 981) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H1226D, ORFNo 5118 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1226D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131118.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence BC002697 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..981 /db_xref="H-InvDB:HIT000269152" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H1226D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>981 /codon_start=1 /gene="PPP1CB" /db_xref="GOA:P62140" /db_xref="H-InvDB:HIT000269152.13" /db_xref="HGNC:HGNC:9282" /db_xref="InterPro:IPR004843" /db_xref="InterPro:IPR006186" /db_xref="InterPro:IPR029052" /db_xref="InterPro:IPR031675" /db_xref="UniProtKB/Swiss-Prot:P62140" /protein_id="CAG47080.1" /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREI FLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLET ICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPI AAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGEN DRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFD NAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR" BASE COUNT 274 a 167 c 244 g 296 t ORIGIN 1 atggcggacg gggagctgaa cgtggacagc ctcatcaccc ggctgctgga ggtacgagga 61 tgtcgtccag gaaagattgt gcagatgact gaagcagaag ttcgaggctt atgtatcaag 121 tctcgggaga tctttctcag ccagcctatt cttttggaat tggaagcacc gctgaaaatt 181 tgtggagata ttcatggaca gtatacagat ttactgagat tatttgaata tggaggtttc 241 ccaccagaag ccaactatct tttcttagga gattatgtgg acagaggaaa gcagtctttg 301 gaaaccattt gtttgctatt ggcttataaa atcaaatatc cagagaactt ctttctctta 361 agaggaaacc atgagtgtgc tagcatcaat cgcatttatg gattctatga tgaatgcaaa 421 cgaagattta atattaaatt gtggaagacc ttcactgatt gttttaactg tctgcctata 481 gcagccattg tggatgagaa gatcttctgt tgtcatggag gattgtcacc agacctgcaa 541 tctatggagc agattcggag aattatgaga cctactgatg tccctgatac aggtttgctc 601 tgtgatttgc tatggtctga tccagataag gatgtgcaag gctggggaga aaatgatcgt 661 ggtgtttcct ttacttttgg agctgatgta gtcagtaaat ttctgaatcg tcatgattta 721 gatttgattt gtcgagctca tcaggtggtg gaagatggat atgaattttt tgctaaacga 781 cagttggtaa ccttattttc agccccaaat tactgtggcg agtttgataa tgctggtgga 841 atgatgagtg tggatgaaac tttgatgtgt tcatttcaga tattgaaacc atctgaaaag 901 aaagctaaat accagtatgg tggactgaat tctggacgtc ctgtcactcc acctcgaaca 961 gctaatccgc cgaagaaaag g //