LOCUS CR542283 942 bp mRNA linear HUM 29-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E1126D for gene TACSTD1, tumor-associated calcium signal transducer 1; complete cds, without stopcodon. ACCESSION CR542283 VERSION CR542283.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 942) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 942) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E1126D, ORFNo 5110 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1126D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131116.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence M32306 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..942 /db_xref="H-InvDB:HIT000269150" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E1126D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>942 /codon_start=1 /gene="TACSTD1" /db_xref="GOA:P16422" /db_xref="H-InvDB:HIT000269150.12" /db_xref="HGNC:HGNC:11529" /db_xref="InterPro:IPR000716" /db_xref="InterPro:IPR036857" /db_xref="InterPro:IPR041630" /db_xref="PDB:4MZV" /db_xref="PDB:6I07" /db_xref="UniProtKB/Swiss-Prot:P16422" /protein_id="CAG47078.1" /translation="MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNR QCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDES GLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSK SLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEK DVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVV IAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA" BASE COUNT 286 a 168 c 241 g 247 t ORIGIN 1 atggcgcccc cgcaggtcct cgcgttcggg cttctgcttg ccgcggcgac ggcgactttt 61 gccgcagctc aggaagaatg tgtctgtgaa aactacaagc tggccgtaaa ctgctttgtg 121 aataataatc gtcaatgcca gtgtacttca gttggtgcac aaaatactgt catttgctca 181 aagctggctg ccaaatgttt ggtgatgaag gcagaaatga atggctcaaa acttgggaga 241 agagcaaaac ctgaaggggc cctccagaac aatgatgggc tttatgatcc tgactgcgat 301 gagagcgggc tctttaaggc caagcagtgc aacggcacct ccatgtgctg gtgtgtgaac 361 actgctgggg tcagaagaac agacaaggac actgaaataa cctgctctga gcgagtgaga 421 acctactgga tcatcattga actaaaacac aaagcaagag aaaaacctta tgatagtaaa 481 agtttgcgga ctgcacttca gaaggagatc acaacgcgtt atcaactgga tccaaaattt 541 atcacgagta ttttgtatga gaataatgtt atcactattg atctggttca aaattcttct 601 caaaaaactc agaatgatgt ggacatagct gatgtggctt attattttga aaaagatgtt 661 aaaggtgaat ccttgtttca ttctaagaaa atggacctga cagtaaatgg ggaacaactg 721 gatctggatc ctggtcaaac tttaatttat tatgttgatg aaaaagcacc tgaattctca 781 atgcagggtc taaaagctgg tgttattgct gttattgtgg ttgtggtgat agcagttgtt 841 gctggaattg ttgtgctggt tatttccaga aagaagagaa tggcaaagta tgagaaggct 901 gagataaagg agatgggtga gatgcatagg gaactcaatg ca //