LOCUS       CR542283                 942 bp    mRNA    linear   HUM 29-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E1126D for
            gene TACSTD1, tumor-associated calcium signal transducer 1;
            complete cds, without stopcodon.
ACCESSION   CR542283
VERSION     CR542283.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 942)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 942)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E1126D, ORFNo 5110
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1126D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131116.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence M32306
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..942
                     /db_xref="H-InvDB:HIT000269150"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E1126D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>942
                     /codon_start=1
                     /gene="TACSTD1"
                     /db_xref="GOA:P16422"
                     /db_xref="H-InvDB:HIT000269150.12"
                     /db_xref="HGNC:HGNC:11529"
                     /db_xref="InterPro:IPR000716"
                     /db_xref="InterPro:IPR036857"
                     /db_xref="InterPro:IPR041630"
                     /db_xref="PDB:4MZV"
                     /db_xref="PDB:6I07"
                     /db_xref="UniProtKB/Swiss-Prot:P16422"
                     /protein_id="CAG47078.1"
                     /translation="MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNR
                     QCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDES
                     GLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSK
                     SLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEK
                     DVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVV
                     IAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA"
BASE COUNT          286 a          168 c          241 g          247 t
ORIGIN      
        1 atggcgcccc cgcaggtcct cgcgttcggg cttctgcttg ccgcggcgac ggcgactttt
       61 gccgcagctc aggaagaatg tgtctgtgaa aactacaagc tggccgtaaa ctgctttgtg
      121 aataataatc gtcaatgcca gtgtacttca gttggtgcac aaaatactgt catttgctca
      181 aagctggctg ccaaatgttt ggtgatgaag gcagaaatga atggctcaaa acttgggaga
      241 agagcaaaac ctgaaggggc cctccagaac aatgatgggc tttatgatcc tgactgcgat
      301 gagagcgggc tctttaaggc caagcagtgc aacggcacct ccatgtgctg gtgtgtgaac
      361 actgctgggg tcagaagaac agacaaggac actgaaataa cctgctctga gcgagtgaga
      421 acctactgga tcatcattga actaaaacac aaagcaagag aaaaacctta tgatagtaaa
      481 agtttgcgga ctgcacttca gaaggagatc acaacgcgtt atcaactgga tccaaaattt
      541 atcacgagta ttttgtatga gaataatgtt atcactattg atctggttca aaattcttct
      601 caaaaaactc agaatgatgt ggacatagct gatgtggctt attattttga aaaagatgtt
      661 aaaggtgaat ccttgtttca ttctaagaaa atggacctga cagtaaatgg ggaacaactg
      721 gatctggatc ctggtcaaac tttaatttat tatgttgatg aaaaagcacc tgaattctca
      781 atgcagggtc taaaagctgg tgttattgct gttattgtgg ttgtggtgat agcagttgtt
      841 gctggaattg ttgtgctggt tatttccaga aagaagagaa tggcaaagta tgagaaggct
      901 gagataaagg agatgggtga gatgcatagg gaactcaatg ca
//