LOCUS       CR542263                 984 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D1126D for
            gene PPP1CB, protein phosphatase 1, catalytic subunit, beta
            isoform; complete cds, incl. stopcodon.
ACCESSION   CR542263
VERSION     CR542263.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 984)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 984)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D1126D, ORFNo 5060
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D1126D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131115.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BC002697
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..984
                     /db_xref="H-InvDB:HIT000269131"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D1126D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..984
                     /codon_start=1
                     /gene="PPP1CB"
                     /db_xref="GOA:P62140"
                     /db_xref="H-InvDB:HIT000269131.13"
                     /db_xref="HGNC:HGNC:9282"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="InterPro:IPR031675"
                     /db_xref="UniProtKB/Swiss-Prot:P62140"
                     /protein_id="CAG47059.1"
                     /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREI
                     FLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLET
                     ICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPI
                     AAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGEN
                     DRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFD
                     NAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
BASE COUNT          275 a          167 c          245 g          297 t
ORIGIN      
        1 atggcggacg gggagctgaa cgtggacagc ctcatcaccc ggctgctgga ggtacgagga
       61 tgtcgtccag gaaagattgt gcagatgact gaagcagaag ttcgaggctt atgtatcaag
      121 tctcgggaga tctttctcag ccagcctatt cttttggaat tggaagcacc gctgaaaatt
      181 tgtggagata ttcatggaca gtatacagat ttactgagat tatttgaata tggaggtttc
      241 ccaccagaag ccaactatct tttcttagga gattatgtgg acagaggaaa gcagtctttg
      301 gaaaccattt gtttgctatt ggcttataaa atcaaatatc cagagaactt ctttctctta
      361 agaggaaacc atgagtgtgc tagcatcaat cgcatttatg gattctatga tgaatgcaaa
      421 cgaagattta atattaaatt gtggaagacc ttcactgatt gttttaactg tctgcctata
      481 gcagccattg tggatgagaa gatcttctgt tgtcatggag gattgtcacc agacctgcaa
      541 tctatggagc agattcggag aattatgaga cctactgatg tccctgatac aggtttgctc
      601 tgtgatttgc tatggtctga tccagataag gatgtgcaag gctggggaga aaatgatcgt
      661 ggtgtttcct ttacttttgg agctgatgta gtcagtaaat ttctgaatcg tcatgattta
      721 gatttgattt gtcgagctca tcaggtggtg gaagatggat atgaattttt tgctaaacga
      781 cagttggtaa ccttattttc agccccaaat tactgtggcg agtttgataa tgctggtgga
      841 atgatgagtg tggatgaaac tttgatgtgt tcatttcaga tattgaaacc atctgaaaag
      901 aaagctaaat accagtatgg tggactgaat tctggacgtc ctgtcactcc acctcgaaca
      961 gctaatccgc cgaagaaaag gtga
//