LOCUS CR542244 375 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0226D for gene UCN, urocortin; complete cds, incl. stopcodon. ACCESSION CR542244 VERSION CR542244.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 375) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 375) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0226D, ORFNo 5013 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0226D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131085.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_003353 (GI:12056477) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..375 /db_xref="H-InvDB:HIT000269112" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0226D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..375 /codon_start=1 /gene="UCN" /db_xref="GOA:P55089" /db_xref="H-InvDB:HIT000269112.11" /db_xref="HGNC:HGNC:12516" /db_xref="InterPro:IPR000187" /db_xref="InterPro:IPR003620" /db_xref="InterPro:IPR018446" /db_xref="PDB:2RMF" /db_xref="PDB:3N96" /db_xref="UniProtKB/Swiss-Prot:P55089" /protein_id="CAG47040.1" /translation="MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGA RNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLEL ARTQSQRERAEQNRIIFDSVGK" BASE COUNT 52 a 128 c 145 g 50 t ORIGIN 1 atgaggcagg cgggacgcgc agcgctgctg gccgcgctgc tgctcctggt acagctgtgc 61 cctgggagca gccagaggag ccccgaggcg gccggggtcc aggacccgag tctgcgctgg 121 agccccgggg cacggaacca gggtggcggg gcccgcgcgc tcctcttgct gctggcggag 181 cgcttcccgc gccgcgcggg gcccggccga ttgggactcg ggacggcagg cgagcggccg 241 cggcgggaca acccttctct gtccattgac ctcacctttc acctgctgcg gaccctgctg 301 gagctggcgc ggacgcagag ccagcgggag cgcgccgagc agaaccgcat catattcgac 361 tcggtgggca agtga //