LOCUS       CR542223                 339 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C1025D for
            gene GC20, translation factor sui1 homolog; complete cds, without
            stopcodon.
ACCESSION   CR542223
VERSION     CR542223.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 339)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 339)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C1025D, ORFNo 4950
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C1025D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131152.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_005875 (GI:5031710)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..339
                     /db_xref="H-InvDB:HIT000269091"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C1025D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>339
                     /codon_start=1
                     /gene="GC20"
                     /db_xref="GOA:Q6FG85"
                     /db_xref="H-InvDB:HIT000269091.13"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005874"
                     /db_xref="InterPro:IPR036877"
                     /db_xref="UniProtKB/TrEMBL:Q6FG85"
                     /protein_id="CAG47019.1"
                     /translation="MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTL
                     TTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGI
                     VKEEQLKVHGF"
BASE COUNT          109 a           68 c           77 g           85 t
ORIGIN      
        1 atgtccacta tccagaacct ccaatctttc gacccctttg ctgatgcaac taagggtgac
       61 gacttactcc cggcagggac tgaggattac attcatataa gaatccagca acggaacggc
      121 agaaagacac tgactactgt tcagggcatt gcagatgatt atgacaaaaa gaaacttgtg
      181 aaagctttca aaaagaaatt tgcctgtaat ggtactgtga ttgaacatcc tgaatacgga
      241 gaggttattc agcttcaagg tgaccaaaga aaaaacatct gccagtttct cttggaggtt
      301 ggcattgtaa aggaggaaca gcttaaggtt catggattc
//