LOCUS CR542223 339 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C1025D for gene GC20, translation factor sui1 homolog; complete cds, without stopcodon. ACCESSION CR542223 VERSION CR542223.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 339) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 339) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C1025D, ORFNo 4950 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C1025D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131152.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005875 (GI:5031710) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..339 /db_xref="H-InvDB:HIT000269091" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C1025D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>339 /codon_start=1 /gene="GC20" /db_xref="GOA:Q6FG85" /db_xref="H-InvDB:HIT000269091.13" /db_xref="InterPro:IPR001950" /db_xref="InterPro:IPR005874" /db_xref="InterPro:IPR036877" /db_xref="UniProtKB/TrEMBL:Q6FG85" /protein_id="CAG47019.1" /translation="MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTL TTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGI VKEEQLKVHGF" BASE COUNT 109 a 68 c 77 g 85 t ORIGIN 1 atgtccacta tccagaacct ccaatctttc gacccctttg ctgatgcaac taagggtgac 61 gacttactcc cggcagggac tgaggattac attcatataa gaatccagca acggaacggc 121 agaaagacac tgactactgt tcagggcatt gcagatgatt atgacaaaaa gaaacttgtg 181 aaagctttca aaaagaaatt tgcctgtaat ggtactgtga ttgaacatcc tgaatacgga 241 gaggttattc agcttcaagg tgaccaaaga aaaaacatct gccagtttct cttggaggtt 301 ggcattgtaa aggaggaaca gcttaaggtt catggattc //