LOCUS CR542216 351 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0625D for gene CART, cocaine- and amphetamine-regulated transcript; complete cds, incl. stopcodon. ACCESSION CR542216 VERSION CR542216.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 351) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 351) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0625D, ORFNo 4931 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0625D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131138.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_004291 (GI:4757909) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..351 /db_xref="H-InvDB:HIT000269084_03" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0625D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..351 /codon_start=1 /gene="CART" /db_xref="GOA:Q16568" /db_xref="H-InvDB:HIT000269084_03.4" /db_xref="HGNC:HGNC:24323" /db_xref="InterPro:IPR009106" /db_xref="InterPro:IPR036722" /db_xref="PDB:1HY9" /db_xref="UniProtKB/Swiss-Prot:Q16568" /protein_id="CAG47012.1" /translation="MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAV DDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDC PRGTSCNSFLLKCL" BASE COUNT 74 a 100 c 107 g 70 t ORIGIN 1 atggagagct cccgcgtgag gctgctgccc ctcctgggcg ccgccctgct gctgatgcta 61 cctctgttgg gtacccgtgc ccaggaggac gccgagctcc agccccgagc cctggacatc 121 tactctgccg tggatgatgc ctcccacgag aaggagctga tcgaagcgct gcaagaagtc 181 ttgaagaagc tcaagagtaa acgtgttccc atctatgaga agaagtatgg ccaagtcccc 241 atgtgtgacg ccggtgagca gtgtgcagtg aggaaagggg caaggatcgg gaagctgtgt 301 gactgtcccc gaggaacctc ctgcaattcc ttcctcctga agtgcttatg a //