LOCUS CR542195 315 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G0824D for gene DNAL4, dynein, axonemal, light polypeptide 4; complete cds, without stopcodon. ACCESSION CR542195 VERSION CR542195.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 315) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 315) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G0824D, ORFNo 4890 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0824D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005740 (GI:5031666) we found AA exchange(s) at position (first base of changed triplet): 172(lys->asn) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..315 /db_xref="H-InvDB:HIT000269064" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G0824D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>315 /codon_start=1 /gene="DNAL4" /db_xref="GOA:O96015" /db_xref="H-InvDB:HIT000269064.12" /db_xref="HGNC:HGNC:2955" /db_xref="InterPro:IPR001372" /db_xref="InterPro:IPR037177" /db_xref="UniProtKB/Swiss-Prot:O96015" /protein_id="CAG46992.1" /translation="MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACE KFSNNNESAAKMINETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVW KCS" BASE COUNT 81 a 77 c 97 g 60 t ORIGIN 1 atgggagaaa cagaagggaa gaaagatgag gctgattata agcgactgca gaccttccct 61 ctggtcaggc actcggacat gccagaggag atgcgcgtgg agaccatgga gctatgtgtc 121 acagcctgtg agaaattctc caacaacaac gagagcgccg ccaagatgat caacgagaca 181 atggacaaga agttcggctc ctcctggcac gtggtgatcg gcgagggctt tgggtttgag 241 atcacccacg aggtgaagaa cctcctctac ctgtacttcg ggggcaccct ggctgtgtgc 301 gtctggaagt gctcc //