LOCUS CR542155 282 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A0124D for gene ATP5J2, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2; complete cds, without stopcodon. ACCESSION CR542155 VERSION CR542155.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 282) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 282) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A0124D, ORFNo 4800 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0124D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_004889 (GI:4757811) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..282 /db_xref="H-InvDB:HIT000269024" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A0124D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>282 /codon_start=1 /gene="ATP5J2" /db_xref="GOA:P56134" /db_xref="H-InvDB:HIT000269024.14" /db_xref="HGNC:HGNC:848" /db_xref="InterPro:IPR019344" /db_xref="UniProtKB/Swiss-Prot:P56134" /protein_id="CAG46952.1" /translation="MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAF QRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH" BASE COUNT 70 a 68 c 78 g 66 t ORIGIN 1 atggcgtcag ttggtgagtg tccggcccca gtaccagtga aggacaagaa acttctggag 61 gtcaaactgg gggagctgcc aagctggatc ttgatgcggg acttcagtcc tagtggcatt 121 ttcggagcgt ttcaaagagg ttactaccgg tactacaaca agtacatcaa tgtgaagaag 181 gggagcatct cggggattac catggtgctg gcatgctacg tgctctttag ctactccttt 241 tcctacaagc atctcaagca cgagcggctc cgcaaatacc ac //