LOCUS CR542137 258 bp mRNA linear HUM 29-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G0123D for gene COX6B, cytochrome c oxidase subunit VIb; complete cds, without stopcodon. ACCESSION CR542137 VERSION CR542137.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 258) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 258) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G0123D, ORFNo 4752 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0123D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_001863 (GI:17999530) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..258 /db_xref="H-InvDB:HIT000269006" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G0123D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>258 /codon_start=1 /gene="COX6B" /db_xref="GOA:P14854" /db_xref="H-InvDB:HIT000269006.12" /db_xref="HGNC:HGNC:2280" /db_xref="InterPro:IPR003213" /db_xref="InterPro:IPR036549" /db_xref="PDB:5Z62" /db_xref="UniProtKB/Swiss-Prot:P14854" /protein_id="CAG46934.1" /translation="MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAM TAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI" BASE COUNT 71 a 75 c 67 g 45 t ORIGIN 1 atggcggaag acatggagac caaaatcaag aactacaaga ccgccccttt tgacagccgc 61 ttccccaacc agaaccagac tagaaactgc tggcagaact acctggactt ccaccgctgt 121 cagaaggcaa tgaccgctaa aggaggcgat atctctgtgt gcgaatggta ccagcgtgtg 181 taccagtccc tctgccccac atcctgggtc acagactggg atgagcaacg ggctgaaggc 241 acgtttcccg ggaagatc //