LOCUS CR542129 273 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D1023D for gene PYY, peptide YY; complete cds, incl. stopcodon. ACCESSION CR542129 VERSION CR542129.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 273) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 273) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D1023D, ORFNo 4727 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D1023D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence D13902 we found AA exchange(s) at position (first base of changed triplet): 214(thr->arg) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..273 /db_xref="H-InvDB:HIT000268998" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D1023D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..273 /codon_start=1 /gene="PYY" /db_xref="GOA:P10082" /db_xref="H-InvDB:HIT000268998.12" /db_xref="HGNC:HGNC:9748" /db_xref="InterPro:IPR001955" /db_xref="InterPro:IPR020392" /db_xref="PDB:2DEZ" /db_xref="PDB:2DF0" /db_xref="PDB:2L60" /db_xref="PDB:2NA5" /db_xref="UniProtKB/Swiss-Prot:P10082" /protein_id="CAG46926.1" /translation="MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEE LNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSR" BASE COUNT 47 a 100 c 80 g 46 t ORIGIN 1 atggtgttcg tgcgcaggcc gtggcccgcc ttgaccacag tgcttctggc cctgctcgtc 61 tgcctagggg cgctggtcga cgcctacccc atcaaacccg aggctcccgg cgaagacgcc 121 tcgccggagg agctgaaccg ctactacgcc tccctgcgcc actacctcaa cctggtcacc 181 cggcagcggt atgggaaaag agacggcccg gacaggcttc tttccaaaac gttcttcccc 241 gacggcgagg accgccccgt caggtcgcgg taa //