LOCUS       CR542112                 909 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0737D for
            gene KLF7, Kruppel-like factor 7 (ubiquitous); complete cds, incl.
            stopcodon.
ACCESSION   CR542112
VERSION     CR542112.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 909)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 909)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0737D, ORFNo 4521
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0737D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131185.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_003709 (GI:4507828)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..909
                     /db_xref="H-InvDB:HIT000268981"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0737D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..909
                     /codon_start=1
                     /gene="KLF7"
                     /db_xref="GOA:O75840"
                     /db_xref="H-InvDB:HIT000268981.13"
                     /db_xref="HGNC:HGNC:6350"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="UniProtKB/Swiss-Prot:O75840"
                     /protein_id="CAG46909.1"
                     /translation="MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQ
                     TEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRD
                     KLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDG
                     TVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRV
                     HRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGA
                     KPFKCNHCDRCFSRSDHLALHMKRHI"
BASE COUNT          220 a          262 c          244 g          183 t
ORIGIN      
        1 atggacgtgt tggctagtta tagtatattc caggagctac aacttgtcca cgacaccggc
       61 tacttctcag ctttaccatc cctggaggag acctggcagc agacatgcct tgaattggaa
      121 cgctacctac agacggagcc ccggaggatc tcagagacct ttggtgagga cttggactgt
      181 ttcctccacg cttcccctcc cccgtgcatt gaggaaagct tccgtcgctt agaccccctg
      241 ctgctccccg tggaagcggc catctgtgag aagagctcgg cagtggacat cttgctctct
      301 cgggacaagt tgctatctga gacctgcctc agcctccagc cggccagctc ttctctagac
      361 agctacacag ccgtcaacca ggcccagctc aacgcagtga cctcattaac gcccccatcg
      421 tcccctgagc tcagccgcca tctggtcaaa acctcacaaa ctctctctgc cgtggatggc
      481 acggtgacgt tgaaactggt ggccaagaag gctgctctca gctccgtaaa ggtgggaggg
      541 gtcgcaacag ctgcagcagc cgtgacggct gcgggggccg ttaagagtgg acagagcgac
      601 agtgaccaag gagggctagg ggctgaagca tgtcccgaaa acaagaagag ggttcaccgc
      661 tgtcagttta acgggtgccg gaaagtttat acaaaaagct cccacttaaa ggcccaccag
      721 aggactcaca caggtgagaa gccttataag tgctcatggg agggatgtga gtggcgtttt
      781 gcacgaagcg atgagctcac gaggcactac aggaaacaca caggtgcaaa gcccttcaaa
      841 tgcaaccact gcgacaggtg tttttccagg tctgaccatc ttgccctcca catgaagaga
      901 catatctaa
//