LOCUS CR542112 909 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0737D for gene KLF7, Kruppel-like factor 7 (ubiquitous); complete cds, incl. stopcodon. ACCESSION CR542112 VERSION CR542112.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 909) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 909) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0737D, ORFNo 4521 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0737D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131185.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_003709 (GI:4507828) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..909 /db_xref="H-InvDB:HIT000268981" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0737D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..909 /codon_start=1 /gene="KLF7" /db_xref="GOA:O75840" /db_xref="H-InvDB:HIT000268981.13" /db_xref="HGNC:HGNC:6350" /db_xref="InterPro:IPR013087" /db_xref="InterPro:IPR036236" /db_xref="UniProtKB/Swiss-Prot:O75840" /protein_id="CAG46909.1" /translation="MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQ TEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRD KLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDG TVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRV HRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGA KPFKCNHCDRCFSRSDHLALHMKRHI" BASE COUNT 220 a 262 c 244 g 183 t ORIGIN 1 atggacgtgt tggctagtta tagtatattc caggagctac aacttgtcca cgacaccggc 61 tacttctcag ctttaccatc cctggaggag acctggcagc agacatgcct tgaattggaa 121 cgctacctac agacggagcc ccggaggatc tcagagacct ttggtgagga cttggactgt 181 ttcctccacg cttcccctcc cccgtgcatt gaggaaagct tccgtcgctt agaccccctg 241 ctgctccccg tggaagcggc catctgtgag aagagctcgg cagtggacat cttgctctct 301 cgggacaagt tgctatctga gacctgcctc agcctccagc cggccagctc ttctctagac 361 agctacacag ccgtcaacca ggcccagctc aacgcagtga cctcattaac gcccccatcg 421 tcccctgagc tcagccgcca tctggtcaaa acctcacaaa ctctctctgc cgtggatggc 481 acggtgacgt tgaaactggt ggccaagaag gctgctctca gctccgtaaa ggtgggaggg 541 gtcgcaacag ctgcagcagc cgtgacggct gcgggggccg ttaagagtgg acagagcgac 601 agtgaccaag gagggctagg ggctgaagca tgtcccgaaa acaagaagag ggttcaccgc 661 tgtcagttta acgggtgccg gaaagtttat acaaaaagct cccacttaaa ggcccaccag 721 aggactcaca caggtgagaa gccttataag tgctcatggg agggatgtga gtggcgtttt 781 gcacgaagcg atgagctcac gaggcactac aggaaacaca caggtgcaaa gcccttcaaa 841 tgcaaccact gcgacaggtg tttttccagg tctgaccatc ttgccctcca catgaagaga 901 catatctaa //