LOCUS       CR542106                 612 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0637D for
            gene RAB30, RAB30, member RAS oncogene family; complete cds, incl.
            stopcodon.
ACCESSION   CR542106
VERSION     CR542106.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 612)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 612)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0637D, ORFNo 4512
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0637D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131177.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_014488 (GI:34147670)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..612
                     /db_xref="H-InvDB:HIT000268975"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0637D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..612
                     /codon_start=1
                     /gene="RAB30"
                     /db_xref="GOA:Q15771"
                     /db_xref="H-InvDB:HIT000268975.11"
                     /db_xref="HGNC:HGNC:9770"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR041820"
                     /db_xref="PDB:2EW1"
                     /db_xref="UniProtKB/Swiss-Prot:Q15771"
                     /protein_id="CAG46903.1"
                     /translation="MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGV
                     DFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPE
                     WLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVE
                     KLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN"
BASE COUNT          179 a          129 c          149 g          155 t
ORIGIN      
        1 atgagtatgg aagattatga tttcctgttc aaaattgttt taattggcaa cgctggtgtg
       61 gggaagacgt gcctcgtccg aagattcact cagggtcttt tccccccagg tcaaggagcc
      121 acaattggag ttgattttat gattaagaca gtggagatta atggtgaaaa agtaaagcta
      181 cagatctggg acacagcagg tcaagagaga tttcggtcca ttacccagag ttactaccga
      241 agcgccaatg ccttgatcct cacctatgac attacctgtg aggaatcctt ccgttgcctt
      301 cctgagtggc tgcgggagat agaacaatat gccagcaaca aggtcatcac tgtgttagtg
      361 ggcaacaaga ttgacctggc tgaaaggaga gaggtttccc agcagcgagc tgaagaattc
      421 tcagaagctc aggacatgta ttatctggag acctcagcca aggaatctga taatgtggag
      481 aaactcttcc ttgacttagc atgccgactc atcagtgaag ccagacagaa cacacttgtg
      541 aacaatgtat cctcaccctt acctggagaa gggaaaagca tcagctattt gacttgttgt
      601 aatttcaact aa
//