LOCUS CR542106 612 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0637D for gene RAB30, RAB30, member RAS oncogene family; complete cds, incl. stopcodon. ACCESSION CR542106 VERSION CR542106.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 612) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 612) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0637D, ORFNo 4512 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0637D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131177.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_014488 (GI:34147670) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..612 /db_xref="H-InvDB:HIT000268975" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0637D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..612 /codon_start=1 /gene="RAB30" /db_xref="GOA:Q15771" /db_xref="H-InvDB:HIT000268975.11" /db_xref="HGNC:HGNC:9770" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="InterPro:IPR041820" /db_xref="PDB:2EW1" /db_xref="UniProtKB/Swiss-Prot:Q15771" /protein_id="CAG46903.1" /translation="MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGV DFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPE WLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVE KLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN" BASE COUNT 179 a 129 c 149 g 155 t ORIGIN 1 atgagtatgg aagattatga tttcctgttc aaaattgttt taattggcaa cgctggtgtg 61 gggaagacgt gcctcgtccg aagattcact cagggtcttt tccccccagg tcaaggagcc 121 acaattggag ttgattttat gattaagaca gtggagatta atggtgaaaa agtaaagcta 181 cagatctggg acacagcagg tcaagagaga tttcggtcca ttacccagag ttactaccga 241 agcgccaatg ccttgatcct cacctatgac attacctgtg aggaatcctt ccgttgcctt 301 cctgagtggc tgcgggagat agaacaatat gccagcaaca aggtcatcac tgtgttagtg 361 ggcaacaaga ttgacctggc tgaaaggaga gaggtttccc agcagcgagc tgaagaattc 421 tcagaagctc aggacatgta ttatctggag acctcagcca aggaatctga taatgtggag 481 aaactcttcc ttgacttagc atgccgactc atcagtgaag ccagacagaa cacacttgtg 541 aacaatgtat cctcaccctt acctggagaa gggaaaagca tcagctattt gacttgttgt 601 aatttcaact aa //