LOCUS CR542099 885 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A1237D for gene CCND1, cyclin D1 (PRAD1: parathyroid adenomatosis 1); complete cds, without stopcodon. ACCESSION CR542099 VERSION CR542099.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 885) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 885) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A1237D, ORFNo 4487 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1237D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131199.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence BC025302 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..885 /db_xref="H-InvDB:HIT000268968" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A1237D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>885 /codon_start=1 /gene="CCND1" /db_xref="GOA:Q6FI00" /db_xref="H-InvDB:HIT000268968.14" /db_xref="InterPro:IPR004367" /db_xref="InterPro:IPR006671" /db_xref="InterPro:IPR013763" /db_xref="InterPro:IPR015451" /db_xref="InterPro:IPR036915" /db_xref="InterPro:IPR039361" /db_xref="UniProtKB/TrEMBL:Q6FI00" /protein_id="CAG46896.1" /translation="MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSY FKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLL GATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLR SPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEE EEEEVDLACTPTDVRDVDI" BASE COUNT 196 a 277 c 265 g 147 t ORIGIN 1 atggaacacc agctcctgtg ctgcgaagtg gaaaccatcc gccgcgcgta ccccgatgcc 61 aacctcctca acgaccgggt gctgcgggcc atgctgaagg cggaggagac ctgcgcgccc 121 tcggtgtcct acttcaaatg tgtgcagaag gaggtcctgc cgtccatgcg gaagatcgtc 181 gccacctgga tgctggaggt ctgcgaggaa cagaagtgcg aggaggaggt cttcccgctg 241 gccatgaact acctggaccg cttcctgtcg ctggagcccg tgaaaaagag ccgcctgcag 301 ctgctggggg ccacttgcat gttcgtggcc tctaagatga aggagaccat ccccctgacg 361 gccgagaagc tgtgcatcta caccgacaac tccatccggc ccgaggagct gctgcaaatg 421 gagctgctcc tggtgaacaa gctcaagtgg aacctggccg caatgacccc gcacgatttc 481 attgaacact tcctctccaa aatgccagag gcggaggaga acaaacagat catccgcaaa 541 cacgcgcaga ccttcgttgc cctctgtgcc acagatgtga agttcatttc caatccgccc 601 tccatggtgg cagcggggag cgtggtggcc gcagtgcaag gcctgaacct gaggagcccc 661 aacaacttcc tgtcctacta ccgcctcaca cgcttcctct ccagagtgat caagtgtgac 721 ccggactgcc tccgggcctg ccaggagcag atcgaagccc tgctggagtc aagcctgcgc 781 caggcccagc agaacatgga ccccaaggcc gccgaggagg aggaagagga ggaggaggag 841 gtggacctgg cttgcacacc caccgacgtg cgggacgtgg acatc //