LOCUS       CR542099                 885 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A1237D for
            gene CCND1, cyclin D1 (PRAD1: parathyroid adenomatosis 1); complete
            cds, without stopcodon.
ACCESSION   CR542099
VERSION     CR542099.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 885)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 885)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A1237D, ORFNo 4487
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1237D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131199.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BC025302
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..885
                     /db_xref="H-InvDB:HIT000268968"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A1237D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>885
                     /codon_start=1
                     /gene="CCND1"
                     /db_xref="GOA:Q6FI00"
                     /db_xref="H-InvDB:HIT000268968.14"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015451"
                     /db_xref="InterPro:IPR036915"
                     /db_xref="InterPro:IPR039361"
                     /db_xref="UniProtKB/TrEMBL:Q6FI00"
                     /protein_id="CAG46896.1"
                     /translation="MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSY
                     FKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLL
                     GATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF
                     IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLR
                     SPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEE
                     EEEEVDLACTPTDVRDVDI"
BASE COUNT          196 a          277 c          265 g          147 t
ORIGIN      
        1 atggaacacc agctcctgtg ctgcgaagtg gaaaccatcc gccgcgcgta ccccgatgcc
       61 aacctcctca acgaccgggt gctgcgggcc atgctgaagg cggaggagac ctgcgcgccc
      121 tcggtgtcct acttcaaatg tgtgcagaag gaggtcctgc cgtccatgcg gaagatcgtc
      181 gccacctgga tgctggaggt ctgcgaggaa cagaagtgcg aggaggaggt cttcccgctg
      241 gccatgaact acctggaccg cttcctgtcg ctggagcccg tgaaaaagag ccgcctgcag
      301 ctgctggggg ccacttgcat gttcgtggcc tctaagatga aggagaccat ccccctgacg
      361 gccgagaagc tgtgcatcta caccgacaac tccatccggc ccgaggagct gctgcaaatg
      421 gagctgctcc tggtgaacaa gctcaagtgg aacctggccg caatgacccc gcacgatttc
      481 attgaacact tcctctccaa aatgccagag gcggaggaga acaaacagat catccgcaaa
      541 cacgcgcaga ccttcgttgc cctctgtgcc acagatgtga agttcatttc caatccgccc
      601 tccatggtgg cagcggggag cgtggtggcc gcagtgcaag gcctgaacct gaggagcccc
      661 aacaacttcc tgtcctacta ccgcctcaca cgcttcctct ccagagtgat caagtgtgac
      721 ccggactgcc tccgggcctg ccaggagcag atcgaagccc tgctggagtc aagcctgcgc
      781 caggcccagc agaacatgga ccccaaggcc gccgaggagg aggaagagga ggaggaggag
      841 gtggacctgg cttgcacacc caccgacgtg cgggacgtgg acatc
//