LOCUS CR542097 750 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0937D for gene LGALS3, lectin, galactoside-binding, soluble, 3 (galectin 3); complete cds, without stopcodon. ACCESSION CR542097 VERSION CR542097.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 750) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 750) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0937D, ORFNo 4477 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0937D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131192.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence M35368 we found AA exchange(s) at position (first base of changed triplet): 742(thr->asn) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..750 /db_xref="H-InvDB:HIT000268966" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0937D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>750 /codon_start=1 /gene="LGALS3" /db_xref="GOA:Q6FGL0" /db_xref="H-InvDB:HIT000268966.13" /db_xref="InterPro:IPR001079" /db_xref="InterPro:IPR013320" /db_xref="InterPro:IPR015534" /db_xref="UniProtKB/TrEMBL:Q6FGL0" /protein_id="CAG46894.1" /translation="MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGA YPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYP ATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFN PRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHL LQYNHRVKKLNEISKLGISGDIDLTSASYNMI" BASE COUNT 186 a 207 c 194 g 163 t ORIGIN 1 atggcagaca atttttcgct ccatgatgcg ttatctgggt ctggaaaccc aaaccctcaa 61 ggatggcctg gcgcatgggg gaaccagcct gctggggcag ggggctaccc aggggcttcc 121 tatcctgggg cctaccccgg gcaggcaccc ccaggggctt atcctggaca ggcacctcca 181 ggcgcctacc ctggagcacc tggagcttat cccggagcac ctgcacctgg agtctaccca 241 gggccaccca gcggccctgg ggcctaccca tcttctggac agccaagtgc ccccggagcc 301 taccctgcca ctggccccta tggcgcccct gctgggccac tgattgtgcc ttataacctg 361 cctttgcctg ggggagtggt gcctcgcatg ctgataacaa ttctgggcac ggtgaagccc 421 aatgcaaaca gaattgcttt agatttccaa agagggaatg atgttgcctt ccactttaac 481 ccacgcttca atgagaacaa caggagagtc attgtttgca atacaaagct ggataataac 541 tggggaaggg aagaaagaca gtcggttttc ccatttgaaa gtgggaaacc attcaaaata 601 caagtactgg ttgaacctga ccacttcaag gttgcagtga atgatgctca cttgttgcag 661 tacaatcatc gggttaaaaa actcaatgaa atcagcaaac tgggaatttc tggtgacata 721 gacctcacca gtgcttcata taacatgata //