LOCUS       CR542097                 750 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0937D for
            gene LGALS3, lectin, galactoside-binding, soluble, 3 (galectin 3);
            complete cds, without stopcodon.
ACCESSION   CR542097
VERSION     CR542097.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 750)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 750)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0937D, ORFNo 4477
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0937D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131192.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence M35368
            we found AA exchange(s) at position (first base of changed
            triplet):
            742(thr->asn)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..750
                     /db_xref="H-InvDB:HIT000268966"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0937D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>750
                     /codon_start=1
                     /gene="LGALS3"
                     /db_xref="GOA:Q6FGL0"
                     /db_xref="H-InvDB:HIT000268966.13"
                     /db_xref="InterPro:IPR001079"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR015534"
                     /db_xref="UniProtKB/TrEMBL:Q6FGL0"
                     /protein_id="CAG46894.1"
                     /translation="MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGA
                     YPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYP
                     ATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFN
                     PRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHL
                     LQYNHRVKKLNEISKLGISGDIDLTSASYNMI"
BASE COUNT          186 a          207 c          194 g          163 t
ORIGIN      
        1 atggcagaca atttttcgct ccatgatgcg ttatctgggt ctggaaaccc aaaccctcaa
       61 ggatggcctg gcgcatgggg gaaccagcct gctggggcag ggggctaccc aggggcttcc
      121 tatcctgggg cctaccccgg gcaggcaccc ccaggggctt atcctggaca ggcacctcca
      181 ggcgcctacc ctggagcacc tggagcttat cccggagcac ctgcacctgg agtctaccca
      241 gggccaccca gcggccctgg ggcctaccca tcttctggac agccaagtgc ccccggagcc
      301 taccctgcca ctggccccta tggcgcccct gctgggccac tgattgtgcc ttataacctg
      361 cctttgcctg ggggagtggt gcctcgcatg ctgataacaa ttctgggcac ggtgaagccc
      421 aatgcaaaca gaattgcttt agatttccaa agagggaatg atgttgcctt ccactttaac
      481 ccacgcttca atgagaacaa caggagagtc attgtttgca atacaaagct ggataataac
      541 tggggaaggg aagaaagaca gtcggttttc ccatttgaaa gtgggaaacc attcaaaata
      601 caagtactgg ttgaacctga ccacttcaag gttgcagtga atgatgctca cttgttgcag
      661 tacaatcatc gggttaaaaa actcaatgaa atcagcaaac tgggaatttc tggtgacata
      721 gacctcacca gtgcttcata taacatgata
//