LOCUS CR542095 696 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0737D for gene VTI1B, vesicle transport through interaction with t-SNAREs homolog 1B (yeast); complete cds, without stopcodon. ACCESSION CR542095 VERSION CR542095.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 696) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 696) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0737D, ORFNo 4468 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0737D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131182.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_006370 (GI:5454165) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..696 /db_xref="H-InvDB:HIT000268964" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0737D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>696 /codon_start=1 /gene="VTI1B" /db_xref="GOA:Q9UEU0" /db_xref="H-InvDB:HIT000268964.11" /db_xref="HGNC:HGNC:17793" /db_xref="InterPro:IPR000727" /db_xref="InterPro:IPR007705" /db_xref="InterPro:IPR010989" /db_xref="InterPro:IPR038407" /db_xref="PDB:2V8S" /db_xref="UniProtKB/Swiss-Prot:Q9UEU0" /protein_id="CAG46892.1" /translation="MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKL IRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTA TPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIG SEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELA ILGGLVYYKFFRSH" BASE COUNT 211 a 167 c 181 g 137 t ORIGIN 1 atggcctcct ccgccgcctc ctcggagcat ttcgagaagc tgcacgagat cttccgcggc 61 ctccatgaag acctacaagg ggtgcccgag cggctgctgg gaacggcggg gaccgaagaa 121 aagaagaaat tgatcaggga ttttgatgaa aagcaacagg aagcaaatga aacgctggca 181 gagatggagg aggagctacg ttatgcacca ctgtctttcc gaaaccctat gatgtctaag 241 cttcgaaact accggaagga ccttgctaaa ctccatcggg aggtgagaag cacacctttg 301 acagccacac ctggaggccg aggagacatg aaatatggca tatatgctgt agagaatgag 361 catatgaatc ggctacagtc tcaaagggca atgcttctgc agggcactga aagcctgaac 421 cgggccaccc aaagtattga acgttctcat cggattgcca cagagactga ccagattggc 481 tcagaaatca tagaagagct gggagaacaa cgagaccagt tagaacgtac caagagtaga 541 ctggtaaaca caagtgaaaa cttgagcaaa agtcggaaga ttctccgttc aatgtccaga 601 aaagtgacaa ccaacaagct gctgctttcc attatcatct tactggagct cgccatcctg 661 ggaggcctgg tttactacaa attctttcgc agccat //