LOCUS       CR542090                 381 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A0537D for
            gene FABP1, fatty acid binding protein 1, liver; complete cds,
            without stopcodon.
ACCESSION   CR542090
VERSION     CR542090.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 381)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 381)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A0537D, ORFNo 4457
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0537D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131170.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_001443 (GI:4557576)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..381
                     /db_xref="H-InvDB:HIT000268959"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A0537D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>381
                     /codon_start=1
                     /gene="FABP1"
                     /db_xref="GOA:Q6FGL7"
                     /db_xref="H-InvDB:HIT000268959.12"
                     /db_xref="InterPro:IPR000463"
                     /db_xref="InterPro:IPR012674"
                     /db_xref="InterPro:IPR031259"
                     /db_xref="InterPro:IPR031276"
                     /db_xref="UniProtKB/TrEMBL:Q6FGL7"
                     /protein_id="CAG46887.1"
                     /translation="MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQN
                     GKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVT
                     ELNGDIITNTMTLGDIVFKRISKRI"
BASE COUNT          126 a           76 c          105 g           74 t
ORIGIN      
        1 atgagtttct ccggcaagta ccaactgcag agccaggaaa actttgaagc cttcatgaag
       61 gcaatcggtc tgccggaaga gctcatccag aaggggaagg atatcaaggg ggtgtcggaa
      121 atcgtgcaga atgggaagca cttcaagttc accatcaccg ctgggtccaa agtgatccaa
      181 aacgaattca cggtggggga ggaatgtgag ctggagacaa tgacagggga gaaagtcaag
      241 acagtggttc agttggaagg tgacaataaa ctggtgacaa ctttcaaaaa catcaagtct
      301 gtgaccgaac tcaacggcga cataatcacc aataccatga cattgggtga cattgtcttc
      361 aagagaatca gcaagagaat t
//