LOCUS CR542083 1134 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0137D for gene PEX14, peroxisomal biogenesis factor 14; complete cds, incl. stopcodon. ACCESSION CR542083 VERSION CR542083.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1134) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1134) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0137D, ORFNo 4440 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0137D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131159.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence BC006327 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1134 /db_xref="H-InvDB:HIT000268952" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0137D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1134 /codon_start=1 /gene="PEX14" /db_xref="GOA:O75381" /db_xref="H-InvDB:HIT000268952.13" /db_xref="HGNC:HGNC:8856" /db_xref="InterPro:IPR006785" /db_xref="InterPro:IPR025655" /db_xref="InterPro:IPR036388" /db_xref="PDB:2W84" /db_xref="PDB:2W85" /db_xref="PDB:4BXU" /db_xref="UniProtKB/Swiss-Prot:O75381" /protein_id="CAG46880.1" /translation="MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQS PLATRRAFLKKKGLTDEEIDMAFQQSGTAADEPSSLGPATQVVPVQPPHLISQPYSPA GSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGREDRKQLERMEAGLSELSGSVA QTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNINELKSEINS LKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSP GKEGHSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDV SHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESERD" BASE COUNT 265 a 336 c 355 g 178 t ORIGIN 1 atggcgtcct cggagcaggc agagcagccg agccagccaa gctctactcc aggaagtgaa 61 aatgtgctgc ctcgagagcc gctgattgcc acggcagtga agtttctaca gaattcccgg 121 gtccgccaga gcccacttgc aaccaggaga gcattcctaa agaagaaagg gctgacagat 181 gaagagattg atatggcctt ccagcagtcg ggcactgctg ccgatgagcc ttcgtccttg 241 ggcccagcca cacaggtggt tcctgtccag ccccctcacc tcatatctca gccatacagt 301 cccgcaggct cccgatggcg agattacggc gccctggcca tcatcatggc aggcattgca 361 tttggctttc accagctcta caagaaatac ctgctccccc tcatcctggg cggccgagag 421 gacagaaagc agctggagag gatggaggcc ggtctctctg agctgagtgg cagcgtggcc 481 cagacagtga ctcagttaca gacgaccctc gcctccgtcc aggagctgct gattcagcag 541 cagcagaaga tccaggagct tgcccacgag ctggccgctg ccaaggccac cacatccacc 601 aactggatcc tggagtccca gaatatcaac gaactcaagt ccgaaattaa ctccttgaaa 661 gggcttcttt taaatcggag gcagttccct ccatccccat cagccccgaa gatcccctcc 721 tggcagatcc cagtcaagtc accgtcaccc tccagccctg cggccgtgaa ccaccacagc 781 agcagcgaca tctcacctgt cagcaacgag tccacgtcgt cctcgcctgg gaaggagggc 841 cacagccccg agggctccac ggtcacctac cacttgctgg gcccccagga ggaaggcgag 901 ggggtggtgg acgtcaaggg ccaggtgcgg atggaggtgc aaggcgagga ggagaagagg 961 gaggacaagg aggacgagga ggatgaggag gatgatgatg tgagccatgt ggacgaggag 1021 gactgcctgg gggtgcagag ggaggaccgc cggggcgggg atgggcagat caacgagcag 1081 gtggagaagc tgcggcggcc cgagggcgcc agcaacgaga gtgagcggga ctag //