LOCUS       CR542083                1134 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0137D for
            gene PEX14, peroxisomal biogenesis factor 14; complete cds, incl.
            stopcodon.
ACCESSION   CR542083
VERSION     CR542083.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1134)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1134)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0137D, ORFNo 4440
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0137D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131159.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BC006327
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1134
                     /db_xref="H-InvDB:HIT000268952"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0137D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1134
                     /codon_start=1
                     /gene="PEX14"
                     /db_xref="GOA:O75381"
                     /db_xref="H-InvDB:HIT000268952.13"
                     /db_xref="HGNC:HGNC:8856"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="PDB:2W84"
                     /db_xref="PDB:2W85"
                     /db_xref="PDB:4BXU"
                     /db_xref="UniProtKB/Swiss-Prot:O75381"
                     /protein_id="CAG46880.1"
                     /translation="MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQS
                     PLATRRAFLKKKGLTDEEIDMAFQQSGTAADEPSSLGPATQVVPVQPPHLISQPYSPA
                     GSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGREDRKQLERMEAGLSELSGSVA
                     QTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNINELKSEINS
                     LKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSP
                     GKEGHSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDV
                     SHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESERD"
BASE COUNT          265 a          336 c          355 g          178 t
ORIGIN      
        1 atggcgtcct cggagcaggc agagcagccg agccagccaa gctctactcc aggaagtgaa
       61 aatgtgctgc ctcgagagcc gctgattgcc acggcagtga agtttctaca gaattcccgg
      121 gtccgccaga gcccacttgc aaccaggaga gcattcctaa agaagaaagg gctgacagat
      181 gaagagattg atatggcctt ccagcagtcg ggcactgctg ccgatgagcc ttcgtccttg
      241 ggcccagcca cacaggtggt tcctgtccag ccccctcacc tcatatctca gccatacagt
      301 cccgcaggct cccgatggcg agattacggc gccctggcca tcatcatggc aggcattgca
      361 tttggctttc accagctcta caagaaatac ctgctccccc tcatcctggg cggccgagag
      421 gacagaaagc agctggagag gatggaggcc ggtctctctg agctgagtgg cagcgtggcc
      481 cagacagtga ctcagttaca gacgaccctc gcctccgtcc aggagctgct gattcagcag
      541 cagcagaaga tccaggagct tgcccacgag ctggccgctg ccaaggccac cacatccacc
      601 aactggatcc tggagtccca gaatatcaac gaactcaagt ccgaaattaa ctccttgaaa
      661 gggcttcttt taaatcggag gcagttccct ccatccccat cagccccgaa gatcccctcc
      721 tggcagatcc cagtcaagtc accgtcaccc tccagccctg cggccgtgaa ccaccacagc
      781 agcagcgaca tctcacctgt cagcaacgag tccacgtcgt cctcgcctgg gaaggagggc
      841 cacagccccg agggctccac ggtcacctac cacttgctgg gcccccagga ggaaggcgag
      901 ggggtggtgg acgtcaaggg ccaggtgcgg atggaggtgc aaggcgagga ggagaagagg
      961 gaggacaagg aggacgagga ggatgaggag gatgatgatg tgagccatgt ggacgaggag
     1021 gactgcctgg gggtgcagag ggaggaccgc cggggcgggg atgggcagat caacgagcag
     1081 gtggagaagc tgcggcggcc cgagggcgcc agcaacgaga gtgagcggga ctag
//