LOCUS CR542068 633 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G0636D for gene TAF11, TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa; complete cds, without stopcodon. ACCESSION CR542068 VERSION CR542068.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 633) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 633) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G0636D, ORFNo 4403 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0636D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131215.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005643 (GI:21269863) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..633 /db_xref="H-InvDB:HIT000268937" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G0636D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>633 /codon_start=1 /gene="TAF11" /db_xref="GOA:Q15544" /db_xref="H-InvDB:HIT000268937.11" /db_xref="HGNC:HGNC:11544" /db_xref="InterPro:IPR006809" /db_xref="InterPro:IPR009072" /db_xref="PDB:1BH8" /db_xref="PDB:1BH9" /db_xref="PDB:6MZD" /db_xref="PDB:6MZL" /db_xref="UniProtKB/Swiss-Prot:Q15544" /protein_id="CAG46865.1" /translation="MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDA DVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDE IQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKV FVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF" BASE COUNT 201 a 132 c 173 g 127 t ORIGIN 1 atggacgatg cccacgagtc gccctccgac aaaggtggag agacagggga gtcggatgag 61 acggccgctg tgcccgggga cccgggggct accgacaccg atggaatccc agaggaaact 121 gacggagacg cagatgtgga cttgaaagaa gctgcagcgg aggaaggcga gctcgagagt 181 caggatgtct cagatttaac aacagttgaa agggaagact catcattact taatcctgca 241 gccaaaaaac tgaaaataga taccaaagaa aagaaagaga aaaagcagaa agtagatgaa 301 gatgagattc agaagatgca aatcctggtt tcttcttttt ctgaggagca gctgaaccgt 361 tatgaaatgt atcgccgctc agctttccct aaggcagcca tcaaaaggct gatccagtcc 421 atcactggca cctctgtgtc tcagaatgtt gttattgcta tgtctggtat ttccaaggtt 481 ttcgtcgggg aggtggtaga agaagcactg gatgtgtgtg agaagtgggg agaaatgcca 541 ccactacaac ccaaacatat gagggaagcc gttagaaggt taaagtcaaa aggacagatc 601 cctaactcga agcacaaaaa aatcatcttc ttc //