LOCUS       CR542068                 633 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G0636D for
            gene TAF11, TAF11 RNA polymerase II, TATA box binding protein
            (TBP)-associated factor, 28kDa; complete cds, without stopcodon.
ACCESSION   CR542068
VERSION     CR542068.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 633)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 633)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G0636D, ORFNo 4403
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0636D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131215.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_005643 (GI:21269863)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..633
                     /db_xref="H-InvDB:HIT000268937"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G0636D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>633
                     /codon_start=1
                     /gene="TAF11"
                     /db_xref="GOA:Q15544"
                     /db_xref="H-InvDB:HIT000268937.11"
                     /db_xref="HGNC:HGNC:11544"
                     /db_xref="InterPro:IPR006809"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PDB:1BH8"
                     /db_xref="PDB:1BH9"
                     /db_xref="PDB:6MZD"
                     /db_xref="PDB:6MZL"
                     /db_xref="UniProtKB/Swiss-Prot:Q15544"
                     /protein_id="CAG46865.1"
                     /translation="MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDA
                     DVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDE
                     IQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKV
                     FVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF"
BASE COUNT          201 a          132 c          173 g          127 t
ORIGIN      
        1 atggacgatg cccacgagtc gccctccgac aaaggtggag agacagggga gtcggatgag
       61 acggccgctg tgcccgggga cccgggggct accgacaccg atggaatccc agaggaaact
      121 gacggagacg cagatgtgga cttgaaagaa gctgcagcgg aggaaggcga gctcgagagt
      181 caggatgtct cagatttaac aacagttgaa agggaagact catcattact taatcctgca
      241 gccaaaaaac tgaaaataga taccaaagaa aagaaagaga aaaagcagaa agtagatgaa
      301 gatgagattc agaagatgca aatcctggtt tcttcttttt ctgaggagca gctgaaccgt
      361 tatgaaatgt atcgccgctc agctttccct aaggcagcca tcaaaaggct gatccagtcc
      421 atcactggca cctctgtgtc tcagaatgtt gttattgcta tgtctggtat ttccaaggtt
      481 ttcgtcgggg aggtggtaga agaagcactg gatgtgtgtg agaagtgggg agaaatgcca
      541 ccactacaac ccaaacatat gagggaagcc gttagaaggt taaagtcaaa aggacagatc
      601 cctaactcga agcacaaaaa aatcatcttc ttc
//