LOCUS CR542064 552 bp mRNA linear HUM 21-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0536D for gene TPD52, tumor protein D52; complete cds, without stopcodon. ACCESSION CR542064 VERSION CR542064.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 552) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 552) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0536D, ORFNo 4395 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0536D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131212.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005079 (GI:4827037) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..552 /db_xref="H-InvDB:HIT000268933" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0536D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>552 /codon_start=1 /gene="TPD52" /db_xref="GOA:P55327" /db_xref="H-InvDB:HIT000268933.11" /db_xref="HGNC:HGNC:12005" /db_xref="InterPro:IPR007327" /db_xref="UniProtKB/Swiss-Prot:P55327" /protein_id="CAG46861.1" /translation="MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELA KVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSET LSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGE VLNSAANASATTTEPLPEKTQESL" BASE COUNT 186 a 121 c 141 g 104 t ORIGIN 1 atggaccgcg gcgagcaagg tctgctgaga acagacccag tccctgagga aggagaagat 61 gttgctgcca cgatcagtgc cacagagacc ctctcggaag aggagcagga agagctaaga 121 agagaacttg caaaggtaga agaagaaatc cagactctgt ctcaagtgtt agcagcaaaa 181 gagaagcatc tagcagagat caagcggaaa cttggaatca attctctaca ggaactaaaa 241 cagaacattg ccaaagggtg gcaagacgtg acagcaacat ctgcttacaa gaagacatct 301 gaaaccttat cccaggctgg acagaaggcc tcagctgctt tttcgtctgt tggctcagtc 361 atcaccaaaa agctggaaga tgtaaaaaac tccccaactt ttaaatcatt tgaagaaaag 421 gtcgaaaact taaagtctaa agtaggggga accaagcctg ctggtggtga ttttggagaa 481 gtcttgaatt cggctgcaaa tgctagtgcc accaccacgg agcctcttcc agaaaagaca 541 caggagagcc tg //