LOCUS       CR542055                1014 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0836D for
            gene PHYH, phytanoyl-CoA hydroxylase (Refsum disease); complete
            cds, without stopcodon.
ACCESSION   CR542055
VERSION     CR542055.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1014)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1014)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0836D, ORFNo 4348
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0836D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131223.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_006214 (GI:17999532)
            we found AA exchange(s) at position (first base of changed
            triplet):
            631(gly->asp)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1014
                     /db_xref="H-InvDB:HIT000268924"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0836D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>1014
                     /codon_start=1
                     /gene="PHYH"
                     /db_xref="H-InvDB:HIT000268924.13"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:Q6FGQ2"
                     /protein_id="CAG46852.1"
                     /translation="MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQF
                     QYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMR
                     DVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLIN
                     KPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPDTHKGSLK
                     PHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRK
                     AISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGE
                     RTNL"
BASE COUNT          284 a          250 c          245 g          235 t
ORIGIN      
        1 atggagcagc ttcgcgccgc cgcccgtctg cagattgttc tgggccacct cggccgcccc
       61 tcggccgggg ctgtcgtagc tcatcccact tcagggacta tttcctctgc cagtttccat
      121 cctcaacaat tccagtatac tctggataat aatgttctaa ccctggaaca gagaaaattt
      181 tatgaagaaa atgggtttct agtaatcaaa aatcttgtac ctgatgccga tattcaacgc
      241 tttcggaatg agtttgaaaa aatctgcaga aaggaggtga aaccattagg attaacagta
      301 atgagagatg tgaccatttc gaaatccgaa tatgctccaa gtgagaagat gatcacgaag
      361 gtccaggatt tccaggaaga taaggagctc ttcagatact gcactctccc cgagattctg
      421 aaatatgtgg agtgcttcac tggacctaat attatggcca tgcacacaat gttgataaac
      481 aaacctccag attctggcaa gaagacgtcc cgtcaccccc tgcaccagga cctgcactat
      541 ttccccttca ggcccagcga tctcatcgtt tgcgcctgga cggcgatgga gcacatcagc
      601 cggaacaacg gctgtctggt tgtgctccca gacacacaca agggctccct gaagccccac
      661 gattacccca agtgggaggg gggagttaac aaaatgttcc acgggatcca ggactacgag
      721 gaaaacaagg cccgggtgca cctggtgatg gagaagggcg acactgtttt cttccatcct
      781 ttgctcatcc acggatctgg tcagaataaa acccagggat tccggaaggc aatttcctgc
      841 catttcgcca gtgccgattg ccactacatt gacgtgaagg gcaccagtca agaaaacatc
      901 gagaaggaag ttgtaggaat agcacataaa ttctttggag ctgaaaatag cgtgaacttg
      961 aaggatattt ggatgtttcg agctcgactt gtgaaaggag aaagaaccaa tctt
//