LOCUS CR542055 1014 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0836D for gene PHYH, phytanoyl-CoA hydroxylase (Refsum disease); complete cds, without stopcodon. ACCESSION CR542055 VERSION CR542055.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1014) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1014) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0836D, ORFNo 4348 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0836D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131223.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_006214 (GI:17999532) we found AA exchange(s) at position (first base of changed triplet): 631(gly->asp) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1014 /db_xref="H-InvDB:HIT000268924" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0836D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>1014 /codon_start=1 /gene="PHYH" /db_xref="H-InvDB:HIT000268924.13" /db_xref="InterPro:IPR008775" /db_xref="UniProtKB/TrEMBL:Q6FGQ2" /protein_id="CAG46852.1" /translation="MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQF QYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMR DVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLIN KPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPDTHKGSLK PHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRK AISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGE RTNL" BASE COUNT 284 a 250 c 245 g 235 t ORIGIN 1 atggagcagc ttcgcgccgc cgcccgtctg cagattgttc tgggccacct cggccgcccc 61 tcggccgggg ctgtcgtagc tcatcccact tcagggacta tttcctctgc cagtttccat 121 cctcaacaat tccagtatac tctggataat aatgttctaa ccctggaaca gagaaaattt 181 tatgaagaaa atgggtttct agtaatcaaa aatcttgtac ctgatgccga tattcaacgc 241 tttcggaatg agtttgaaaa aatctgcaga aaggaggtga aaccattagg attaacagta 301 atgagagatg tgaccatttc gaaatccgaa tatgctccaa gtgagaagat gatcacgaag 361 gtccaggatt tccaggaaga taaggagctc ttcagatact gcactctccc cgagattctg 421 aaatatgtgg agtgcttcac tggacctaat attatggcca tgcacacaat gttgataaac 481 aaacctccag attctggcaa gaagacgtcc cgtcaccccc tgcaccagga cctgcactat 541 ttccccttca ggcccagcga tctcatcgtt tgcgcctgga cggcgatgga gcacatcagc 601 cggaacaacg gctgtctggt tgtgctccca gacacacaca agggctccct gaagccccac 661 gattacccca agtgggaggg gggagttaac aaaatgttcc acgggatcca ggactacgag 721 gaaaacaagg cccgggtgca cctggtgatg gagaagggcg acactgtttt cttccatcct 781 ttgctcatcc acggatctgg tcagaataaa acccagggat tccggaaggc aatttcctgc 841 catttcgcca gtgccgattg ccactacatt gacgtgaagg gcaccagtca agaaaacatc 901 gagaaggaag ttgtaggaat agcacataaa ttctttggag ctgaaaatag cgtgaacttg 961 aaggatattt ggatgtttcg agctcgactt gtgaaaggag aaagaaccaa tctt //