LOCUS CR542032 447 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G1135D for gene RAMP1, receptor (calcitonin) activity modifying protein 1; complete cds, incl. stopcodon. ACCESSION CR542032 VERSION CR542032.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 447) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 447) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G1135D, ORFNo 4300 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G1135D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131284.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005855 (GI:5032018) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..447 /db_xref="H-InvDB:HIT000268901" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G1135D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..447 /codon_start=1 /gene="RAMP1" /db_xref="GOA:O60894" /db_xref="H-InvDB:HIT000268901.12" /db_xref="HGNC:HGNC:9843" /db_xref="InterPro:IPR006985" /db_xref="InterPro:IPR038126" /db_xref="PDB:2YX8" /db_xref="PDB:3N7P" /db_xref="PDB:3N7R" /db_xref="PDB:3N7S" /db_xref="PDB:4RWG" /db_xref="PDB:5V6Y" /db_xref="PDB:6D1U" /db_xref="PDB:6E3Y" /db_xref="UniProtKB/Swiss-Prot:O60894" /protein_id="CAG46829.1" /translation="MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQF QVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFR SCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV" BASE COUNT 69 a 148 c 147 g 83 t ORIGIN 1 atggcccggg ccctgtgccg cctcccgcgg cgcggcctct ggctgctcct ggcccatcac 61 ctcttcatga ccactgcctg ccaggaggct aactacggtg ccctcctccg ggagctctgc 121 ctcacccagt tccaggtaga catggaggcc gtcggggaga cgctgtggtg tgactggggc 181 aggaccatca ggagctacag ggagctggcc gactgcacct ggcacatggc ggagaagctg 241 ggctgcttct ggcccaatgc agaggtggac aggttcttcc tggcagtgca tggccgctac 301 ttcaggagct gccccatctc aggcagggcc gtgcgggacc cgcccggcag catcctctac 361 cccttcatcg tggtccccat cacggtgacc ctgctggtga cggcactggt ggtctggcag 421 agcaagcgca ctgagggcat tgtgtag //