LOCUS CR542022 795 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0735D for gene AQP5, aquaporin 5; complete cds, without stopcodon. ACCESSION CR542022 VERSION CR542022.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 795) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 795) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0735D, ORFNo 4274 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0735D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131269.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_001651 (GI:4502182) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..795 /db_xref="H-InvDB:HIT000268891" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0735D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>795 /codon_start=1 /gene="AQP5" /db_xref="GOA:P55064" /db_xref="H-InvDB:HIT000268891.13" /db_xref="HGNC:HGNC:638" /db_xref="InterPro:IPR000425" /db_xref="InterPro:IPR022357" /db_xref="InterPro:IPR023271" /db_xref="InterPro:IPR023276" /db_xref="InterPro:IPR034294" /db_xref="PDB:3D9S" /db_xref="PDB:5C5X" /db_xref="PDB:5DYE" /db_xref="UniProtKB/Swiss-Prot:P55064" /protein_id="CAG46819.1" /translation="MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQ IALAFGLAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIAGA GILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTSPVGS PALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAA ILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR" BASE COUNT 121 a 273 c 232 g 169 t ORIGIN 1 atgaagaagg aggtgtgctc cgtggccttc ctcaaggccg tgttcgcaga gttcttggcc 61 accctcatct tcgtcttctt tggcctgggc tcggccctca agtggccgtc ggcgctgcct 121 accatcctgc agatcgcgct ggcgtttggc ctggccatag gcacgctggc ccaggccctg 181 ggacccgtga gcggcggcca catcaacccc gccatcaccc tggccctctt ggtgggcaac 241 cagatctcgc tgctccgggc tttcttctac gtggcggccc agctggtggg cgccattgcc 301 ggggctggca tcctctacgg tgtggcaccg ctcaatgccc ggggcaatct ggccgtcaac 361 gcgctcaaca acaacacaac gcagggccag gccatggtgg tggagctgat tctgaccttc 421 cagctggcac tctgcatctt cgcctccact gactcccgcc gcaccagccc tgtgggctcc 481 ccagccctgt ccattggcct gtctgtcacc ctgggccacc ttgtcggaat ctacttcact 541 ggctgctcca tgaacccagc ccgctctttt ggccctgcgg tggtcatgaa tcggttcagc 601 cccgctcact gggttttctg ggtagggccc atcgtggggg cggtcctggc tgccatcctt 661 tacttctacc tgctcttccc caactccctg agcctgagtg agcgtgtggc catcatcaaa 721 ggcacgtatg agcctgacga ggactgggag gagcagcggg aagagcggaa gaagaccatg 781 gagctgacca cccgc //