LOCUS       CR542022                 795 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0735D for
            gene AQP5, aquaporin 5; complete cds, without stopcodon.
ACCESSION   CR542022
VERSION     CR542022.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 795)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 795)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0735D, ORFNo 4274
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0735D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131269.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_001651 (GI:4502182)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..795
                     /db_xref="H-InvDB:HIT000268891"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0735D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>795
                     /codon_start=1
                     /gene="AQP5"
                     /db_xref="GOA:P55064"
                     /db_xref="H-InvDB:HIT000268891.13"
                     /db_xref="HGNC:HGNC:638"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="InterPro:IPR023276"
                     /db_xref="InterPro:IPR034294"
                     /db_xref="PDB:3D9S"
                     /db_xref="PDB:5C5X"
                     /db_xref="PDB:5DYE"
                     /db_xref="UniProtKB/Swiss-Prot:P55064"
                     /protein_id="CAG46819.1"
                     /translation="MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQ
                     IALAFGLAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIAGA
                     GILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTSPVGS
                     PALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAA
                     ILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR"
BASE COUNT          121 a          273 c          232 g          169 t
ORIGIN      
        1 atgaagaagg aggtgtgctc cgtggccttc ctcaaggccg tgttcgcaga gttcttggcc
       61 accctcatct tcgtcttctt tggcctgggc tcggccctca agtggccgtc ggcgctgcct
      121 accatcctgc agatcgcgct ggcgtttggc ctggccatag gcacgctggc ccaggccctg
      181 ggacccgtga gcggcggcca catcaacccc gccatcaccc tggccctctt ggtgggcaac
      241 cagatctcgc tgctccgggc tttcttctac gtggcggccc agctggtggg cgccattgcc
      301 ggggctggca tcctctacgg tgtggcaccg ctcaatgccc ggggcaatct ggccgtcaac
      361 gcgctcaaca acaacacaac gcagggccag gccatggtgg tggagctgat tctgaccttc
      421 cagctggcac tctgcatctt cgcctccact gactcccgcc gcaccagccc tgtgggctcc
      481 ccagccctgt ccattggcct gtctgtcacc ctgggccacc ttgtcggaat ctacttcact
      541 ggctgctcca tgaacccagc ccgctctttt ggccctgcgg tggtcatgaa tcggttcagc
      601 cccgctcact gggttttctg ggtagggccc atcgtggggg cggtcctggc tgccatcctt
      661 tacttctacc tgctcttccc caactccctg agcctgagtg agcgtgtggc catcatcaaa
      721 ggcacgtatg agcctgacga ggactgggag gagcagcggg aagagcggaa gaagaccatg
      781 gagctgacca cccgc
//