LOCUS CR542010 609 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0235D for gene RAB7L1, RAB7, member RAS oncogene family-like 1; complete cds, without stopcodon. ACCESSION CR542010 VERSION CR542010.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 609) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 609) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0235D, ORFNo 4253 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0235D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131250.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_003929 (GI:4506374) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..609 /db_xref="H-InvDB:HIT000268879" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0235D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>609 /codon_start=1 /gene="RAB7L1" /db_xref="GOA:Q6FGU7" /db_xref="H-InvDB:HIT000268879.12" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="InterPro:IPR030697" /db_xref="UniProtKB/TrEMBL:Q6FGU7" /protein_id="CAG46807.1" /translation="MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDF ALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRW KQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENK NINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC" BASE COUNT 159 a 149 c 165 g 136 t ORIGIN 1 atgggcagcc gcgaccacct gttcaaagtg ctggtggtgg gggacgccgc agtgggcaag 61 acgtcgctgg tgcagcgata ttcccaggac agcttcagca aacactacaa gtccacggtg 121 ggagtggatt ttgctctgaa ggttctccag tggtctgact acgagatagt gcggcttcag 181 ctgtgggata ttgcagggca ggagcgcttc acctctatga cacgattgta ttatcgggat 241 gcctctgcct gtgttattat gtttgacgtt accaatgcca ctaccttcag caacagccag 301 aggtggaaac aggacctaga cagcaagctc acactaccca atggagagcc ggtgccctgc 361 ctgctcttgg ccaacaagtg tgatctgtcc ccttgggcag tgagccggga ccagattgac 421 cggttcagta aagagaacgg tttcacaggt tggacagaaa catcagtcaa ggagaacaaa 481 aatattaatg aggctatgag agtcctcatt gaaaagatga tgagaaattc cacagaagat 541 atcatgtctt tgtccaccca aggggactac atcaatctac aaaccaagtc ctccagctgg 601 tcctgctgc //