LOCUS CR542008 594 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0235D for gene YKT6, SNARE protein Ykt6; complete cds, without stopcodon. ACCESSION CR542008 VERSION CR542008.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 594) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 594) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0235D, ORFNo 4251 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0235D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131248.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_006555 (GI:34304384) we found AA exchange(s) at position (first base of changed triplet): 187(asp->asn) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..594 /db_xref="H-InvDB:HIT000268877" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0235D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>594 /codon_start=1 /gene="YKT6" /db_xref="GOA:O15498" /db_xref="H-InvDB:HIT000268877.11" /db_xref="HGNC:HGNC:16959" /db_xref="InterPro:IPR001388" /db_xref="InterPro:IPR010908" /db_xref="InterPro:IPR011012" /db_xref="UniProtKB/Swiss-Prot:O15498" /protein_id="CAG46805.1" /translation="MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTS QLIVERSSKGTRASVKEQNYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFS KQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMTKVQAELDETKIILHNTMESL LERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM" BASE COUNT 165 a 152 c 143 g 134 t ORIGIN 1 atgaagctgt acagcctcag cgtcctctac aaaggcgagg ccaaggtggt gctgctcaaa 61 gccgcatacg atgtgtcttc cttcagcttt ttccagagat ccagcgttca ggaattcatg 121 accttcacga gtcaactgat tgtggagcgc tcatcgaaag gcactagagc ttctgtcaaa 181 gaacaaaact atctgtgcca cgtctacgtc cggaatgata gtcttgcagg tgtggtcatt 241 gctgacaatg aatacccatc ccgggtggcc tttaccttgc tggagaaggt actagatgaa 301 ttctccaagc aagtcgacag gatagactgg ccagtaggat cccctgctac aatccattac 361 ccagccctgg atggtcacct cagtagatac cagaacccac gagaagctga tcccatgact 421 aaagtgcagg ccgaactaga tgagaccaaa atcattctgc acaacaccat ggagtctctg 481 ttagagcgag gtgagaagct agatgacttg gtgtccaaat ccgaggtgct gggaacgcag 541 tctaaagcct tctataaaac tgcccggaaa caaaactcat gctgtgccat catg //