LOCUS       CR541998                 576 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B1135D for
            gene PMVK, phosphomevalonate kinase; complete cds, without
            stopcodon.
ACCESSION   CR541998
VERSION     CR541998.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 576)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 576)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B1135D, ORFNo 4239
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B1135D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131282.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_006556 (GI:20127505)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..576
                     /db_xref="H-InvDB:HIT000268867"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B1135D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>576
                     /codon_start=1
                     /gene="PMVK"
                     /db_xref="GOA:Q6FGV9"
                     /db_xref="H-InvDB:HIT000268867.13"
                     /db_xref="InterPro:IPR005919"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FGV9"
                     /protein_id="CAG46795.1"
                     /translation="MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLS
                     GPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQP
                     IWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDN
                     FGDFDWVIENHGVEQRLEEQLENLIEFIRSRL"
BASE COUNT          122 a          144 c          197 g          113 t
ORIGIN      
        1 atggccccgc tgggaggcgc cccgcggctg gtactgctgt tcagcggcaa gaggaaatcc
       61 gggaaggact tcgtgaccga ggcgctgcag agcagacttg gagctgatgt ctgtgctgtc
      121 ctccggctct ctggtccact caaggaacag tatgctcagg agcatggctt gaacttccag
      181 agactcctgg acaccagcac ctacaaggag gcctttcgga aggacatgat ccgctgggga
      241 gaggagaaac gccaggctga cccaggcttc ttttgcagga agattgtgga gggcatctcc
      301 cagcccatct ggctggtgag tgacacacgg agagtgtctg acatccagtg gtttcgggag
      361 gcctatgggg ccgtgacgca gacggtccgc gttgtagcgt tggagcagag ccgacagcag
      421 cggggctggg tgttcacgcc aggggtggac gatgctgagt cagaatgtgg cctggacaac
      481 ttcggggact ttgactgggt catcgagaac catggagttg aacagcgcct ggaggagcag
      541 ttggagaacc tgatagaatt tatccgctcc agactt
//