LOCUS CR541993 537 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0835D for gene IL10, interleukin 10; complete cds, incl. stopcodon. ACCESSION CR541993 VERSION CR541993.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 537) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 537) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0835D, ORFNo 4221 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0835D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131273.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_000572 (GI:24430216) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..537 /db_xref="H-InvDB:HIT000268862" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0835D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..537 /codon_start=1 /gene="IL10" /db_xref="GOA:Q6FGW4" /db_xref="H-InvDB:HIT000268862.12" /db_xref="InterPro:IPR000098" /db_xref="InterPro:IPR009079" /db_xref="InterPro:IPR020423" /db_xref="InterPro:IPR020443" /db_xref="UniProtKB/TrEMBL:Q6FGW4" /protein_id="CAG46790.1" /translation="MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDL RDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQD PDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSE FDIFINYIEAYMTMKIRN" BASE COUNT 146 a 136 c 140 g 115 t ORIGIN 1 atgcacagct cagcactgct ctgttgcctg gtcctcctga ctggggtgag ggccagccca 61 ggccagggca cccagtctga gaacagctgc acccacttcc caggcaacct gcctaacatg 121 cttcgagatc tccgagatgc cttcagcaga gtgaagactt tctttcaaat gaaggatcag 181 ctggacaact tgttgttaaa ggagtccttg ctggaggact ttaagggtta cctgggttgc 241 caagccttgt ctgagatgat ccagttttac ctggaggagg tgatgcccca agctgagaac 301 caagacccag acatcaaggc gcatgtgaac tccctggggg agaacctgaa gaccctcagg 361 ctgaggctac ggcgctgtca tcgatttctt ccctgtgaaa acaagagcaa ggccgtggag 421 caggtgaaga atgcctttaa taagctccaa gagaaaggca tctacaaagc catgagtgag 481 tttgacatct tcatcaacta catagaagcc tacatgacaa tgaagatacg aaactga //